KEGG   Phaeobacter inhibens DSM 17395: PGA1_c33180Help
Entry
PGA1_c33180       CDS       T02192                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00071  Fatty acid degradation
pga00072  Synthesis and degradation of ketone bodies
pga00280  Valine, leucine and isoleucine degradation
pga00310  Lysine degradation
pga00362  Benzoate degradation
pga00380  Tryptophan metabolism
pga00620  Pyruvate metabolism
pga00630  Glyoxylate and dicarboxylate metabolism
pga00640  Propanoate metabolism
pga00650  Butanoate metabolism
pga00900  Terpenoid backbone biosynthesis
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
pga01200  Carbon metabolism
pga01212  Fatty acid metabolism
pga02020  Two-component system
Module
pga_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA1_c33180
   00630 Glyoxylate and dicarboxylate metabolism
    PGA1_c33180
   00640 Propanoate metabolism
    PGA1_c33180
   00650 Butanoate metabolism
    PGA1_c33180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PGA1_c33180
   00072 Synthesis and degradation of ketone bodies
    PGA1_c33180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA1_c33180
   00310 Lysine degradation
    PGA1_c33180
   00380 Tryptophan metabolism
    PGA1_c33180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGA1_c33180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PGA1_c33180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PGA1_c33180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pga04147]
    PGA1_c33180
Enzymes [BR:pga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGA1_c33180
Exosome [BR:pga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGA1_c33180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFO92958
UniProt: I7ERI7
Position
complement(3477702..3478874)
Genome map
AA seq 390 aa AA seqDB search
MKTVVIAGAARTPMGGFQGMYDGVAAAELGGSAIRAALAGAGATTVDEILMGCVLPAGQG
QAPARQAGFAAGLGEEVPATTLNKMCGSGMKAAMMAYDQIALGQADTMIAGGMESMTNAP
YLLPKMRNGARLGHGQVVDHMFLDGLEDAYDKGRLMGTFAEDCAETYQFTREAQDEYALT
SLSNALAAQESGAFDAEIAPVTVKTRKGETVTNADEQPKSARPDKIPTLKPAFRKDGTVT
AANASSISDGAAALVLASEDAAEAQGLTVRARIMGHASHAQAPGLFTTAPVPAAKKLMAQ
LGWTVSDVDLWEVNEAFAVVPMAFMHEMGLPRDKVNVNGGACALGHPIGASGARIMVTLL
NALEKRNLKRGIAAICIGGGEGTAIAIERM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgttgtgatcgcaggcgcggcccgcaccccgatgggcggatttcagggcatg
tacgacggcgtcgcagccgccgagctgggcggctctgcaattcgcgcggcgcttgcgggg
gcaggggccaccactgtcgatgaaattctgatgggctgtgtgctgcccgcgggtcagggg
caggcgccagcgcggcaggcagggttcgcagctggcctgggcgaagaggtgccggcaacc
acgctgaacaagatgtgcggctcgggcatgaaggcggcgatgatggcctatgatcagatc
gcgttgggtcaggcggacaccatgatcgcgggcgggatggagagcatgacaaatgcacca
tatctgctgccaaagatgcgcaatggggcgcggctcggtcacgggcaggtggtcgatcat
atgtttttggacgggcttgaggatgcttatgacaaaggtcgcctgatgggcacctttgcc
gaggactgtgcggagacctatcagttcacgcgggaagcacaggatgaatacgcgctgaca
tcgctgtcaaatgcgctggcagcgcaggaaagcggtgcctttgatgccgagatcgcgccc
gtcaccgtcaaaacccgcaagggcgagacagtcactaacgcggatgagcagcccaaatca
gcacgccctgacaagattccgacactgaaaccggccttccgtaaggatggtaccgtcacc
gcagccaatgcctcgtcgatctcggatggcgccgccgcattggtgctggcctctgaagat
gccgcagaagcccagggtctgactgtacgcgcccgcatcatgggtcatgccagtcacgcc
caggcgccggggttattcacaacggctccggttccggcagccaaaaagctgatggcgcag
ctcggctggacggtcagcgatgtggacctttgggaggtgaacgaagcctttgccgtcgtg
ccaatggccttcatgcatgaaatggggctgccgcgtgacaaagtgaacgtcaacggtggc
gcctgtgctttgggccatccgatcggtgcctccggcgcgcgtatcatggtcacattgctg
aacgcattggagaaacgcaacctgaagcgcggcattgcagccatttgcatcggcggcggc
gagggcacggccatcgctattgagcgcatgtga

DBGET integrated database retrieval system