KEGG   Photobacterium gaetbulicola: H744_1c0577Help
Entry
H744_1c0577       CDS       T03698                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00071  Fatty acid degradation
pgb00072  Synthesis and degradation of ketone bodies
pgb00280  Valine, leucine and isoleucine degradation
pgb00310  Lysine degradation
pgb00362  Benzoate degradation
pgb00380  Tryptophan metabolism
pgb00620  Pyruvate metabolism
pgb00630  Glyoxylate and dicarboxylate metabolism
pgb00640  Propanoate metabolism
pgb00650  Butanoate metabolism
pgb00900  Terpenoid backbone biosynthesis
pgb01100  Metabolic pathways
pgb01110  Biosynthesis of secondary metabolites
pgb01120  Microbial metabolism in diverse environments
pgb01130  Biosynthesis of antibiotics
pgb01200  Carbon metabolism
pgb01212  Fatty acid metabolism
pgb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H744_1c0577
   00630 Glyoxylate and dicarboxylate metabolism
    H744_1c0577
   00640 Propanoate metabolism
    H744_1c0577
   00650 Butanoate metabolism
    H744_1c0577
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H744_1c0577
   00072 Synthesis and degradation of ketone bodies
    H744_1c0577
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H744_1c0577
   00310 Lysine degradation
    H744_1c0577
   00380 Tryptophan metabolism
    H744_1c0577
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H744_1c0577
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H744_1c0577
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H744_1c0577
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgb04147]
    H744_1c0577
Enzymes [BR:pgb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H744_1c0577
Exosome [BR:pgb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H744_1c0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJR05602
UniProt: A0A0C5WHE3
Position
1:672655..673863
Genome map
AA seq 402 aa AA seqDB search
MAKVYIVAAKRTPIGSFNGALKSVPAPQLAAVAIKAALEEANVDPANLDEVILGNVVGAG
QGMGPGRQAAIYAGVPQEVPAYSLNMVCGSGMKAVMDAAAHIKAGDAELVVAAGAENMSQ
IPFCAPATIRDGQKMGSLSLDDLLISDGLTDVFNKYHMGVTAENVVAKVGLTREQQDNFA
LASQQKAVAAIEQGKFAGEIAPVEVTIRRKTSVVDTDEYPKADASIEGLAKLRPAFKKEG
GSVTAGNASGINDGASAIIVASEAAVEKYGLTPLAEIESYAQAGIAPEVMGLGPVPAVIK
ALDKAELNIADVGLFEFNEAFAGQALGVLHELADELGSQVEDLAERSNVNGGAIALGHPL
GASGNRIIVSLLHEMRRRGTEHGLATLCVGGGMGTAIVLKSV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtatatatcgttgcggctaaacgtacgcctatcggtagtttcaatggtgcg
ctgaaatcagtgcctgctcctcaacttgccgcagtggcaattaaagcggcgttggaagag
gcaaacgtagaccctgctaatcttgatgaagttattctaggtaatgtagttggtgctgga
caaggtatgggccctggccgtcaggcagctatctatgccggtgttcctcaggaagtacca
gcttacagcttaaacatggtctgtggctcgggtatgaaagcggttatggatgctgctgct
catatcaaggccggtgatgctgaacttgtcgttgctgccggtgcagagaatatgtcccag
atcccattctgcgcacccgctacaattcgtgatggtcagaaaatgggctctctaagcctt
gacgatctacttatttctgatggtctgacggatgtgttcaataagtaccacatgggtgta
acagctgaaaatgttgttgccaaagtgggccttacccgtgagcaacaagacaactttgcc
ttggcaagccagcaaaaagcggttgccgcgattgagcaaggcaagttcgccggtgaaatt
gcccctgttgaagtgactattcgcagaaaaaccagcgttgtagataccgatgagtatcca
aaggcggacgcaagtattgaaggcttggcgaaactacgcccggcattcaagaaagagggt
ggttctgtaacagcgggtaatgcgtcaggcatcaacgacggtgctagtgcgattattgtt
gcctcagaagccgccgtcgaaaaatatggcctaacaccgttagctgaaattgaaagctat
gctcaagcaggcattgccccagaggttatgggactcggtcctgtacctgctgtgattaaa
gcacttgataaagcagagctaaacattgctgatgttggtttgttcgaattcaatgaagct
tttgcgggtcaggctctgggtgtattacacgaattggccgacgagctagggtctcaagta
gaagacttggccgagcgttccaatgttaatggtggtgcgattgcattgggacaccctcta
ggtgcttcaggtaaccgtattattgtcagccttcttcacgaaatgcgccgccgcggcact
gaacatggcttagccacgttgtgtgttggtggtggtatgggtacagcgattgtactgaag
agcgtctaa

DBGET integrated database retrieval system