KEGG   Photobacterium gaetbulicola: H744_2c0325Help
Entry
H744_2c0325       CDS       T03698                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H744_2c0325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pgb01007]
    H744_2c0325
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pgb03016]
    H744_2c0325
Enzymes [BR:pgb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     H744_2c0325
Amino acid related enzymes [BR:pgb01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   H744_2c0325
Transfer RNA biogenesis [BR:pgb03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    H744_2c0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1 BTAD
Motif
Other DBs
NCBI-ProteinID: AJR07069
UniProt: A0A0C5WPT6
Position
2:complement(342327..344396)
Genome map
AA seq 689 aa AA seqDB search
MAEHNFLIELGTEELPPTALRTLAEAFAANFEAELKAADLPHQGVKWFASPRRLALKVAG
LAENQPDKVVEKRGPAISVAFDADGNPTKAAQGWARGNGITVEQADRLVTDKGEWLLFKQ
EVKGQAADALLCDMAANALAKLPIPKPMRWGDTDTQFIRPVKTLTMLLGDKLIPGTILGV
ESARTIRGHRFMGEAEFTIDNADQYPAILEERGKVMADYEARKAIILADAQKAAEAVGGK
ADLEDELVEEVTSLVEWPVVLTASFEEDFLNVPSEALVYTMKGDQKYFPVYDADGNLVPK
FIFVTNIISKDPQQIIEGNEKVVRPRLADAEFFFNTDRKRPLIDRLPELETAIFQKQLGT
IKDKTDRITELAGYIAEKIDADVTNAKRAGLLAKCDLMTSMVFEFTDTQGVMGMHYARHD
GEAEEVALALNEQYMPRFAGDELPSTGVSASVAMADKLDTLVGIFGIGQAPKGSDPFALR
RAALGVLRIIVEKGYNLDLVDLIAKAQSLFGDKLTNANVADEVIDFMLGRFRAWYQDEGH
SVDVIQAVLALRPTQPADFDKRVKAVTHFRSLDAAESLAAANKRVGNILAKFDGELASGV
DSSLLVEDAEKALAADIASTLEQLAPVFAEGDYQQALSELANLREPVDAFFDNVMVMADD
EKLKVNRLTMLNQLRNEFLKVADISLLQK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacacaatttccttattgaacttggtaccgaagagctaccgccaacggcactg
cgcacactggcagaagcctttgcagcaaacttcgaagctgagttgaaagcagcagaccta
ccacaccagggtgtgaagtggtttgcttctcctcgccgcctggcacttaaggttgctggc
cttgctgaaaaccagcctgacaaggtggtagaaaagcgcggcccggcgatttctgtggca
ttcgatgcagacggtaacccaaccaaagcggctcaaggctgggcacgtggtaatggcatc
accgttgaacaagctgaccgcctggttaccgacaaaggcgaatggctactgttcaagcaa
gaagtcaaaggccaagcggctgatgcactgctatgcgatatggctgccaatgcgcttgct
aaactgccaattcctaagccaatgcgctggggtgacacagacactcagtttatccgtccg
gtgaaaaccctgaccatgcttctgggtgacaagctgatcccgggtactatcctgggtgtg
gaatctgcacgcactattcgtggccaccgcttcatgggtgaagctgagtttactatcgac
aatgccgatcagtatccagcgatcctggaagagcgcggtaaggtaatggctgattacgaa
gcacgtaaagccatcatcttggctgatgcccagaaagctgctgaagcggttggcggtaaa
gccgaccttgaagacgagctggttgaagaagtgacgtctctggttgaatggcctgtcgta
ctgactgcatctttcgaagaagacttcctgaacgtaccgtctgaagcgctggtttacacc
atgaaaggtgaccagaaatacttcccggtttacgacgcagatggcaacctagtgcctaag
ttcatcttcgtaaccaacatcatttcgaaagatcctcaacaaatcatcgaaggtaacgag
aaggttgtccgccctcgtcttgccgatgcagagttcttcttcaacaccgaccgtaagcgt
ccactgattgatcgcctgcctgaactagaaacagctatcttccagaagcagctaggtacg
atcaaagacaagactgaccgtatcactgaacttgctggctacattgccgaaaagatcgat
gctgatgtgactaacgctaaacgcgctggcctactggccaagtgtgacctgatgacctcc
atggtattcgaatttaccgatacccagggtgtgatgggcatgcactacgctcgccatgac
ggtgaagcagaagaagtcgctctagcgctaaacgagcaatacatgccacgctttgccggt
gacgaactgccaagcacaggcgtgtcagcgtctgttgcgatggcagacaagctagatacg
ctagtgggtatcttcggcattggccaggcaccgaaaggttctgacccatttgccctgcgc
cgtgcagcgctaggtgttctacgtatcatcgttgagaaaggctacaacctagatttggtt
gacctgattgccaaagcacaatcactattcggcgacaagctaacgaacgccaatgtggca
gacgaagtgatcgacttcatgctaggccgcttccgtgcttggtaccaagacgaaggccac
agcgttgacgttatccaggcggtactggcactacgccctacccagcctgctgatttcgac
aagcgtgttaaagcggtaacacacttccgctctctagacgctgctgaatcactagcagcc
gccaacaagcgtgtgggtaacatcctagcgaaattcgatggtgaactagcttcaggtgtt
gatagcagcctattggttgaagatgcagaaaaagcattggcggctgatatcgcatcaacg
ctagaacagcttgcgcctgtctttgccgaaggtgattaccagcaggcactgtcagaacta
gcaaaccttcgtgagccagttgatgcgttcttcgacaacgtgatggttatggctgatgac
gagaagctaaaagtgaatcgtcttaccatgctgaaccagctacgtaacgagttcctaaaa
gtggcagatatttcgctactgcaaaagtaa

DBGET integrated database retrieval system