KEGG   Photobacterium gaetbulicola: H744_2c0566Help
Entry
H744_2c0566       CDS       T03698                                 

Definition
(GenBank) hypothetical protein
Organism
pgb  Photobacterium gaetbulicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_6 HTH_22 HTH_23 DUF658 dCache_1 HTH_7 HTH_17
Motif
Other DBs
NCBI-ProteinID: AJR07302
UniProt: A0A0C5WLZ0
Position
2:598373..599143
Genome map
AA seq 256 aa AA seqDB search
MAQKLNRMGNSKEDRRVVSTENFGSEVMVESDLIEPRAFSEHDYIILRSYEAVVDGLAAL
IGPFCEIVLHSLADLNTSAIKIANGENTGRKVGSPITDLALRMLRDIEGSERNFSRAYFT
RAKGGDLMKSITIAIRNGDNDIIGLLCININLDAPFSQILQSFMPTDEAKQAASSVNFAS
DVDELVDQTVERTIEEINADKNVSNNAKNRQIVMELFDKGIFDIKDAINRVADRLNISKH
TVYLYIRQRKTEDGEK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaagttaaatagaatgggcaacagcaaggaagatagacgcgtggtatctact
gaaaactttggctcagaagtgatggtcgagagtgacttgattgagccgcgtgcttttagc
gagcacgattacattatcttacgttcgtatgaggcggtggttgacggtttggcggccttg
attggtccgttctgtgaaatcgtgctgcactcgctggccgatctgaacacgtcggcgatt
aagattgccaatggtgagaatactggtcgtaaagtgggctcgccgatcaccgatcttgcc
ctgcgcatgctgcgagatatcgaaggctctgagcgtaacttctctcgtgcctactttacc
cgcgccaagggcggtgatttgatgaagtcgatcactatcgctatccgcaatggcgacaat
gacatcatcggtctattgtgtatcaacatcaatttggatgcgccgttctcgcagatcctg
cagtcctttatgccgactgatgaagccaagcaggcggcctcgagtgtcaacttcgccagt
gatgtcgacgagctggtggatcagacggtcgagcgtaccatcgaagagatcaatgccgac
aagaatgtgtcgaataatgccaagaaccgccagatcgtgatggaactgttcgacaaaggc
atttttgatatcaaagatgcgatcaaccgggtggccgatcgtctcaatatttccaagcat
acggtctacctctacatccgccagcgtaaaaccgaggatggcgaaaaatga

DBGET integrated database retrieval system