KEGG   Photobacterium gaetbulicola: H744_2c1260Help
Entry
H744_2c1260       CDS       T03698                                 

Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00020  Citrate cycle (TCA cycle)
pgb00640  Propanoate metabolism
pgb00660  C5-Branched dibasic acid metabolism
pgb01100  Metabolic pathways
pgb01110  Biosynthesis of secondary metabolites
pgb01120  Microbial metabolism in diverse environments
pgb01130  Biosynthesis of antibiotics
pgb01200  Carbon metabolism
Module
pgb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H744_2c1260
   00640 Propanoate metabolism
    H744_2c1260
   00660 C5-Branched dibasic acid metabolism
    H744_2c1260
Enzymes [BR:pgb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     H744_2c1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AJR07939
UniProt: A0A0C5WS71
Position
2:1319320..1320192
Genome map
AA seq 290 aa AA seqDB search
MSVLINKDTKVICQGFTGGQGTFHSEQAIEYGTQMVGGVSPGKGGTTHLGLPVFNTVREA
VEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLDVKVRLDEAGVRMI
GPNCPGVITPDECKIGIMPGHIHRAGKVGIVSRSGTLTYEAVKQTTDEGFGQSTCVGIGG
DPIPGSNFIDVLELFENDPATEAIVMIGEIGGTAEEEAAAYIKQNVSKPVVSYIAGVTAP
PGKRMGHAGAIISGGKGTAEDKFQALEAAGVKTVKSLADIGKALREVTGW
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgctaattaacaaagataccaaggtgatctgtcagggttttactggcggtcaa
ggtacattccactcagagcaagccattgagtacggaacacagatggtcggtggtgtttct
ccgggtaaaggcggcactacgcaccttggtctgcctgtatttaataccgtgcgtgaagcc
gttgaagccactggcgcaacggcaactgtgatctatgtaccggcaccattctgcaaggat
gcgatccttgaagcgattgatgcgggtatcgagctgattgtcaccatcactgaaggtatt
ccgacgctggatatgctggatgtgaaagtacgccttgatgaagctggtgtgcgtatgatt
ggtccaaactgcccgggggtgatcacgccggacgagtgtaagatcgggatcatgccgggc
cacatccacagagcgggcaaagtcggtatcgtatctcgctcgggtacgctgacttatgaa
gcggtgaagcaaaccacagatgaaggcttcggccagtcaacttgtgtcggtatcggtggt
gacccaattccagggtcgaactttatcgatgtgcttgagctgttcgaaaacgatccggcg
accgaggcgattgtgatgatcggtgagatcggcggtacggccgaagaagaagcggcggca
tacatcaagcaaaatgtcagcaagccggtggtttcatacattgcgggtgtgacggcacct
ccaggcaagcgcatgggccacgctggtgcgattatttctggcggtaaaggtacggccgaa
gataagttccaggcgctggaagctgcgggtgtgaaaaccgtgaagagccttgccgatatt
ggtaaagcactgcgcgaagtcactggttggtaa

DBGET integrated database retrieval system