KEGG   Photobacterium gaetbulicola: H744_2c3332Help
Entry
H744_2c3332       CDS       T03698                                 

Definition
(GenBank) putative phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pgb  Photobacterium gaetbulicola
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    H744_2c3332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJR09964
UniProt: A0A0C5WY86
Position
2:3769723..3770991
Genome map
AA seq 422 aa AA seqDB search
MEILANYGTILILVAAFFGLLMAIGIGANDVANAMGTSVGSKALTVKQAIIIAMIFEFAG
AYLAGGEVTDTIRKGVIDTSLYAANPEVLVYGMMSALLAAGTWLLVASYMGWPVSTTHSI
IGAIIGFACVSVGTDAVDWSSVQGIVGSWLITPLISGLFAYAIFISAQRLIFDTDNPVIN
AKRFVPVYMFMTTIVIALVTIKKGLKHVGLHLSSGEAWLASVAVSLIVMVFGYIYINRKY
TDDGSTVDSNGYAGVERIFSLLMVVTACAMAFAHGSNDVANAIGPLSAVVTTVQNMGEIT
AKSQIAWWILPLGGFGIVIGLATMGHKVMATVGTGITELTPSRGFAAQLATASTVVLASG
TGLPISTTQTLVGGVIGVAFARGIAALNLGVVRNIVASWVVTLPAGALLAVIFYYAMQAV
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctggctaactacggcaccattctcattttggtggcggctttttttggtcta
ttgatggctattggtattggcgcaaatgatgttgccaacgccatgggtacctcggtcggt
tctaaagcactgacggttaaacaagcaatcatcattgcgatgatcttcgagtttgcgggt
gcttacctagcaggtggtgaagttacagataccatccgcaaaggggttatcgacacctcg
ctatatgctgccaatccggaagtattggtgtacggcatgatgtcagccctattggctgca
ggtacttggttactggttgcgtcctacatgggctggccggtatctactactcactccatt
attggtgccatcatcggttttgcctgtgtttcagtaggtactgacgctgttgactggagc
tctgttcagggcatcgtcggcagttggcttatcacaccgttgatctcggggctgtttgct
tatgctattttcatcagcgcccagcgcctgatcttcgatactgataacccagtaatcaat
gctaagcgcttcgtgcctgtctacatgttcatgaccacgatcgtaatcgctctagttacg
atcaaaaagggtctgaaacacgtaggccttcacctctcaagcggtgaagcatggctggca
tctgtagctgtgtccctcattgtaatggtgtttggttacatttatattaaccgtaaatac
acagacgacggttcgaccgttgatagcaatggatatgccggtgttgagcgtattttcagc
ctgctgatggtggttacagcttgtgcgatggcctttgcccacggctctaacgatgtagcc
aatgctatcggtcctctttctgccgttgtcactacagttcagaacatgggtgaaatcacg
gccaagagtcaaatcgcttggtggatcttgccgttaggtggcttcggtatcgttatcggc
ctagccacaatgggccacaaggttatggccaccgttggtaccggtattaccgaactaacg
ccaagccgtggctttgctgcccagctagcgactgcctctaccgttgttcttgcatcgggt
acgggtcttcctatttcaaccacccaaacattagtcggtggtgtcattggtgttgccttt
gcccgtggtatcgcagcactgaacctgggtgtggtccgtaatatcgttgcctcttgggtt
gttaccctaccagctggcgccctgcttgcagtcattttctactacgcaatgcaagctgtg
tttagttaa

DBGET integrated database retrieval system