KEGG   Pseudomyrmex gracilis: 109851761Help
Entry
109851761         CDS       T05003                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00030  Pentose phosphate pathway
pgc00480  Glutathione metabolism
pgc01100  Metabolic pathways
pgc01200  Carbon metabolism
Module
pgc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pgc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    109851761
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109851761
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     109851761
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     109851761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 Shikimate_DH F420_oxidored
Motif
Other DBs
NCBI-GeneID: 109851761
NCBI-ProteinID: XP_020277742
Position
Unknown
AA seq 482 aa AA seqDB search
MSTPVADIALIGLAVMGQNLILNMNDHGFVVCAYNRTTDKVKSFLENEAKGTKIIGAYSL
KEMVSTLKSPRKVMMLVKAGSAVDAFIEQLVPLLSPGDIIIDGGNSEYQDTERRTKDLEQ
KGILFVGTGVSGGEDGARYGPSLMPGGNPKAWPHIKPIFQSIAAKADGEPCCDWVGETGA
GHFVKMVHNGIEYGDMQIICEAYHLMRSGLQLTQGEMSKVFDEWNNNVLESFLIEITRDI
LKYKDEKGYLLERIRDTAGQKGTGKWTAIAALDYGVPVTLIGESVFSRCLSALKNERVEA
SAVLTGPDSVYKGDKKKFLEHLRNALYVAKIISYAQGFMLLREAAKVHNWNLNYGGIALM
WRGGCIIRSSFLGNIKAAYDKNPKLSNLLLDNFFARVMNEYHTSARVVVSAAVTMGIPTP
ALSTALAFYDGFRTGRLPANLLQAQRDYFGAHTYELLGQEGKFIHTNWTGHGGKVSASTY
DA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccggtagcagatatcgccctcatcgggttggcagtcatgggacagaattta
attctgaacatgaatgatcatggatttgttgtatgcgcgtacaatcgcaccacggacaaa
gttaaatcgtttctcgagaatgaagctaaaggtacaaaaataattggtgcttatagcttg
aaggagatggtcagtacactgaagagtccgagaaaagtaatgatgttagttaaagctggt
tcagctgtggatgcattcattgagcaactggtgcctcttctctctcctggagacattatc
attgacggtggcaactctgagtatcaagataccgagagacgcacgaaagacttggagcaa
aaaggaattctttttgtgggtactggtgttagtggaggagaagatggtgcaagatatggg
ccatccttgatgccaggtggcaatcccaaggcgtggccgcatattaaacctattttccag
tcgatagcagcaaaagctgacggagagccatgttgcgactgggtcggcgagactggcgct
gggcacttcgtcaagatggtgcataacggcattgagtatggcgacatgcagatcatctgc
gaggcgtatcacttgatgcgcagcggccttcagctcacgcagggcgagatgagcaaggta
tttgatgaatggaacaacaatgttctcgaatctttcctgattgagattacgcgcgatata
ctcaagtacaaggacgagaaaggttacttgctcgagcgtatcagagacacagcaggccag
aaaggcactggcaaatggacagcaatcgcagcgctagattacggcgtgccggtcacgcta
atcggcgaatcggtgttctcgagatgtctgtccgcgctgaagaatgagcgcgtggaagct
agcgcagtgctgacgggtccggattcagtatacaaaggcgataagaaaaagtttttagaa
cacttgcgaaacgctctgtacgtcgcaaaaattatttcgtacgcgcaaggcttcatgttg
ctcagagaagctgccaaggtccacaattggaatctaaattatggtggaatagcattgatg
tggcgaggtggatgtattataagaagctcatttttgggaaatataaaagcagcgtatgac
aaaaatccaaaattgtccaacttattgttggacaatttctttgctcgtgttatgaacgaa
tatcacacgagtgccagggtggttgtgagtgccgctgtaacaatgggtataccaactccc
gctttgtcaacggctctggcattttacgatggattcagaactggtcgattgccggcgaac
ttgctgcaggcccagcgcgattatttcggggctcatacttacgaattgcttggtcaggaa
ggaaagttcattcataccaactggaccggacacggtggaaaagtatccgcttctacgtat
gatgcataa

DBGET integrated database retrieval system