KEGG   Pseudomyrmex gracilis: 109851785Help
Entry
109851785         CDS       T05003                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00350  Tyrosine metabolism
pgc00360  Phenylalanine metabolism
pgc00380  Tryptophan metabolism
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109851785
   00360 Phenylalanine metabolism
    109851785
   00380 Tryptophan metabolism
    109851785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgc04147]
    109851785
Enzymes [BR:pgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109851785
    4.1.1.105  L-tryptophan decarboxylase
     109851785
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109851785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109851785
NCBI-ProteinID: XP_020277800
Position
Unknown
AA seq 526 aa AA seqDB search
MDTAEFVEFAKASIDFVANYLETLRDRNVLPNVQPGYLSKLLPEEAPQKSEKWQEVLKDV
ERYIIPGMTHWNSPHFHAYFPTANSYPGIVAEMMSSAFSCIGFSWTSSPVCTELEVLMCN
WLCKLLDLPDKFLFTNDGTGGGIIQGSASECTLVCILAAKDYTMRRIKTLNPEMDENTIK
SKLVAYTSIQSNCSVEKAASLGSVQIRLLPVDDKHSLLGATLRKAVEEDLAKGLIPCCVI
ATLGTTGTCGFDKLDEIGPVCEEYDIWLHIDAAYAGAAFLCPEYRYLMSGIEYADSFNVN
AHKWLLVNFDASVMWVKDTKRLTDAFSIERIYLPHSNAELPDYRNWQIHLGRRFRSLKLW
FVFRIYGQEGLQNHIRQQIKLAKLFEEYVLSDARFEVVTKAFMALVCFRVKGDDSLTKKL
FDRLQARKRIYVVASTYQDKYVIRFVICSRLCREDDVAFAWNEISSQATELLQEEHYKTS
VENIAKVTDDNVKVSNIANEHNIAPAFLSSEYLHETFAKELSSRHI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggatacggcagaatttgtggaatttgccaaagcatcgatcgattttgttgcaaattac
ctcgagactttgagagacagaaacgtattgcctaatgtacagccgggttatctcagtaag
ttattgccggaggaagcgccgcaaaaatccgaaaagtggcaggaagtcctgaaggatgtg
gagcgatacattatacctggaatgacacattggaattcgccacattttcacgcgtacttc
cctacggctaattcttatcctggaatcgtcgctgaaatgatgagtagcgcgtttagttgt
ataggattttcttggacctcgtctccagtttgtaccgaacttgaagttcttatgtgcaac
tggctttgcaaattattggatcttcccgacaaatttttatttaccaacgatggaacaggt
ggaggaatcatacagggatctgcaagtgaatgtactttagtgtgtatactggctgcgaaa
gactacacaatgcgtcgtataaaaactcttaatccagaaatggacgagaatactattaag
tctaaattggtggcatatacttccattcagtcaaattgttcggtggaaaaggccgcttct
ttgggttctgtgcaaataagattgttgccggtggacgacaaacattctttactcggagca
acattgagaaaagctgtggaagaggatttggcaaaaggtcttattccttgttgcgtcatc
gctaccttaggaactaccggcacatgtggattcgacaagctcgacgagattggtcctgtc
tgtgaagaatacgacatatggctgcatattgacgctgcttacgcaggtgcagcatttctt
tgccctgaatatcgttatttaatgtccggtattgagtatgcagattcttttaatgtaaac
gctcacaaatggctgctagtaaatttcgatgcttccgtaatgtgggtaaaagatacgaaa
cgactcactgatgcatttagtatagagagaatctatcttcctcacagtaacgcagagcta
cctgattacagaaattggcagattcacttgggcagacgttttcgttcgttaaaattgtgg
tttgtctttcggatttacggacaggaaggacttcaaaatcatattcggcaacaaataaaa
ttggcaaagctctttgaagaatatgttttgtcggacgccagatttgaagtagtaaccaaa
gcttttatggctcttgtgtgtttccgtgtcaagggcgatgacagtttaacaaagaaactc
tttgatcgtctacaggccagaaaacgtatctacgttgttgctagcacgtatcaagataag
tatgtcatcagatttgtcatttgcagtcgattgtgtcgggaagacgacgtagccttcgca
tggaacgaaataagcagtcaggcaacagaattattgcaagaggaacattataagacctca
gtcgagaatattgcaaaagtgacagacgataatgtaaaagtgtcaaatatcgccaatgag
cataatatcgcacctgcatttctcagttcagaatacttgcacgaaacgtttgcaaaagag
ctaagtagtcgacacatatag

DBGET integrated database retrieval system