KEGG   Pseudomyrmex gracilis: 109851786Help
Entry
109851786         CDS       T05003                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00350  Tyrosine metabolism
pgc00360  Phenylalanine metabolism
pgc00380  Tryptophan metabolism
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109851786
   00360 Phenylalanine metabolism
    109851786
   00380 Tryptophan metabolism
    109851786
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgc04147]
    109851786
Enzymes [BR:pgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109851786
    4.1.1.105  L-tryptophan decarboxylase
     109851786
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109851786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase YmgD
Motif
Other DBs
NCBI-GeneID: 109851786
NCBI-ProteinID: XP_020277802
Position
Unknown
AA seq 480 aa AA seqDB search
MDPDSFKEYAKDMAEYVTNYLENIRDRKVLPTVEPGYMNPLLPSEAPQTPDQWKDIMTDI
ERVIMPGVTHWHSPKFHAYFPTAQSYPAILADMLSGAIACIGFTWIASPACTELEVIMLD
WLGKMLDLPKEFLACNGGKGGGVIQGTASEATLVALLGAKARKIKQIKEQHPDWTDSEII
SKLVAYCSCQAHSSVERAGLLGGVQFRQLEVDDKYRLCGDSLAEAIRKDKEHGFIPFYAV
ATLGTTVSCAFDRLDEMGIVTTREDIWLHVDAAYAGSSFICPEFRYLMKGIELADSFNFN
PHKWMLVNFDCSAMWLKDPTYVINAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKL
WFVLRLYGVENLQKFIRKHIAQAHEFEALVLTDPRFEIVGDVLMGLVCFRLKGSNELNEA
LLKKINGAGNIHLVPSKIKDTYFLRFAVCSRFSESKDIQYSWKEIKLRANEVLEEHSVSK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgacagcttcaaggagtacgccaaggatatggcggaatacgtcaccaattat
ttagaaaatatcagagataggaaggtcttgcctaccgtagaaccgggatacatgaatcca
cttctaccttccgaggcaccgcaaactcccgatcagtggaaagacattatgaccgacatc
gaaagagtgataatgccaggtgttactcactggcacagtccgaaattccacgcgtacttt
cccactgcgcaatcgtatcctgcgattctagccgacatgttgagcggagctatcgcgtgt
atcggatttacgtggattgccagtccggcttgtaccgagttggaagtgatcatgttggat
tggttgggaaaaatgttggacttgccgaaggaatttcttgcctgcaacggcggaaagggc
ggtggtgttattcagggaactgcgagcgaggccactttagtggcgttactgggagcaaag
gctagaaaaataaagcaaattaaagaacagcatcccgattggacggatagcgagatcatc
agcaaactagtcgcatactgttcctgccaagcgcacagctcggtcgagcgcgccggactt
cttggtggagtgcagttcagacaattggaagtagatgacaaatatagattgtgcggtgat
tcgttggccgaagcaatccgaaaggataaagagcacggatttataccgttttacgcagtc
gcgaccttagggaccaccgtttcttgcgcatttgatcgtctcgacgaaatgggcatcgtg
acgactcgcgaggacatttggttgcacgtggacgctgcttacgcgggatcttcctttatt
tgtccggaatttcgatacttgatgaaaggcatcgagctggcggactcgtttaattttaat
ccccacaaatggatgctggttaactttgattgctccgccatgtggctcaaagacccgacc
tacgtcatcaacgctttcaatgtcgatcctctgtatctaaagcacgacatgcaggggtcg
gcgccggattacaggcactggcagattccactcggacgtagattccgagcactgaagctc
tggttcgtactgagactctatggcgtggagaatctacaaaagttcattagaaaacacatc
gctcaggcgcacgaattcgaagcgttagttctcaccgatcctcgcttcgaaatcgtcggc
gacgttctcatgggactcgtttgtttccgcctaaaaggttccaacgagctcaacgaagct
ctcttgaagaaaatcaacggcgccggaaacattcatctcgtaccgtctaagatcaaagac
acgtactttctgcgattcgccgtttgctctcgtttcagcgagagcaaggacatacaatat
tcctggaaggagatcaagctgagagccaacgaggttctcgaagagcactcggtttcgaag
tga

DBGET integrated database retrieval system