KEGG   Pseudomyrmex gracilis: 109853409Help
Entry
109853409         CDS       T05003                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109853409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pgc03011]
    109853409
Ribosome [BR:pgc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    109853409
  Bacteria
    109853409
  Archaea
    109853409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 109853409
NCBI-ProteinID: XP_020281118
Position
Unknown
AA seq 222 aa AA seqDB search
MQAIRQCVRNAALYSRFVVNKSDVSNVAKTLNLIPTCSFHLSSICEKHYPDFTTPTKFLK
YNETIFPPQKPGEERRPAYVCHMKANIKYSPKKMWYIAYYIRGMSVDEAIKAVSFMRRKG
GEIVKEVLLEAQKLAVEEHNVEFKSNLWVAESFATKGMVIKGLRRHARGRGTVHRYRYCH
YFVRLEEGQPPKNYHLRTSKTGEELLNNWLQNMHMRKVVNSL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccattcgtcagtgtgtgagaaatgcagcgttgtacagcagatttgttgtaaac
aaatcggatgtatcaaatgtggcaaagacgttaaatctcataccaacatgtagcttccat
ctttcgtcgatatgcgaaaagcattatccagatttcacaactcccacaaagtttctcaag
tataatgaaaccatttttccacctcaaaaacctggcgaggaaagaaggcctgcctacgta
tgtcatatgaaggccaacataaagtatagcccaaaaaagatgtggtatatcgcgtattac
atacgaggaatgtctgtggacgaagctataaaagcagtgagttttatgagaagaaaaggt
ggtgagattgtcaaagaggttctattagaagctcaaaaactggctgtagaagaacacaat
gtcgagttcaagagtaatttgtgggttgctgaatcattcgccacgaaaggtatggtaata
aaaggtctgagacgtcacgctagaggtcgcggaacggttcatcggtacaggtattgtcat
tattttgtacgtttggaggaaggacaaccacccaagaattatcatctgagaacttccaag
accggcgaggaattattgaacaactggttgcagaatatgcacatgcgcaaagtagttaat
tccttgtaa

DBGET integrated database retrieval system