KEGG   Pseudomyrmex gracilis: 109854551Help
Entry
109854551         CDS       T05003                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00790  Folate biosynthesis
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109854551
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     109854551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase Peptidase_S66
Motif
Other DBs
NCBI-GeneID: 109854551
NCBI-ProteinID: XP_020283337
Position
Unknown
AA seq 240 aa AA seqDB search
MSTVLGRVIVYGGKGALGSACVSQFKSRNWWVGSIDMKSNEQADANIIVNPESNWQQQQV
EVLAQIKDTLKDEKVDGIICVAGGWAGGNAIHKDFIKNCDLMWKQSVWSSVLAANIAAEC
LKKGGFLTLTGAKAALEGTPGMIGYGMAKAAVHQLTSSLAAKNSGLPEDSLVVAILPVTL
DTPMNRKWMPNADTSTWTPLDFVSNLFWEWSQNQDRPANGSLLQLITKDNKTQVIQASKM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtactcggacgtgtaattgtgtacgggggcaagggcgctcttggctcggcc
tgcgtctcccaatttaaatcgcgaaattggtgggttggttccattgatatgaaatcaaat
gaacaagcggatgcaaatatcatagtaaatccggagagtaattggcaacagcagcaagta
gaagttttggcccaaatcaaggacacattgaaagatgagaaggttgacggtattatttgc
gtagccggaggttgggcgggtggcaatgcaatccacaaagatttcataaagaattgcgat
ctcatgtggaaacagagcgtttggagttcggttttagcagctaacatcgcggccgaatgc
ttgaagaagggaggcttccttacattgaccggtgccaaagcggcactggaaggaacacca
ggtatgatcggctacggtatggcaaaggcggcggttcatcagctgacaagttctttagct
gccaaaaacagcggacttccagaagatagtttggtagtcgctatactacctgttactttg
gatacgccaatgaatagaaagtggatgcccaatgctgatacgagcacctggactccactt
gactttgtgtcaaatttgttctgggagtggtcgcagaatcaagatcgacctgctaatggt
tctcttctgcaactcattaccaaggacaacaagacgcaagtgattcaggcttccaaaatg
taa

DBGET integrated database retrieval system