KEGG   Pseudomyrmex gracilis: 109855089Help
Entry
109855089         CDS       T05003                                 

Definition
(RefSeq) probable arginine--tRNA ligase, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109855089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pgc01007]
    109855089
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pgc03016]
    109855089
   03029 Mitochondrial biogenesis [BR:pgc03029]
    109855089
Enzymes [BR:pgc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     109855089
Amino acid related enzymes [BR:pgc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   109855089
Transfer RNA biogenesis [BR:pgc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109855089
 Prokaryotic type
   Other AARSs
    109855089
Mitochondrial biogenesis [BR:pgc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109855089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1
Motif
Other DBs
NCBI-GeneID: 109855089
NCBI-ProteinID: XP_020284518
Position
Unknown
AA seq 561 aa AA seqDB search
MSNSVRTAILRKITDSVSNINVLDIASCLHLKPHKANGVYSYLLPLKTNQYDIQNQVQNI
LTHDPSNIFDVGIEKNAISFSLSREKHIKNVLEHNCSTISAPSFVSEKKNVIVEFSSPNI
AKPFHMGHLRSTIVGNYIANINSFVKNNVKRINYLGDWGTQYGLIQLGVDMASIHEDEMK
NNPIKSLYTAYVTANKLAETDSSVLQRAREIFKDLETGTGVTFEQWKMFKQYTVEELKRT
YGRIGITFDEYHWESMYNARKIEKIIAMMEDMQLLVTDELNRKVVNLENEKSVPVIKSDG
STLYIARDIAAAIDRFEKNNFDRMYYVVDNAQINYFSNLLEILRRMKMPWVDRLRHVQFG
RLNGLRTRKGNITFLEEILDTARDVMKQKQIDSSTTKVRLDSTDNSSDILGISAMIVNDL
KRRRQRDYTFDWNAAFDLKGDTGVKLQYAHCRLVNLERNCGAVLVSECEPSLLREEVVDD
LVILISNFEEVVLRSYEEMESCVLTAYLFNLTRAINRAFKTLRVKNEAPDVASQRLLLFH
VSKNVLAQGMKLLGLMPLEEM
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatagtgtaagaactgcaattttgagaaagattacagactccgtttccaacata
aacgtactcgacatcgcgtcttgtttgcatttaaagcctcacaaagccaacggagtctat
tcgtatctattacctttgaaaacgaatcaatatgacatacagaatcaagtgcaaaatatt
ttaactcacgatccaagtaacatcttcgacgtaggtatagaaaaaaacgctatctctttc
agtctgtctcgagagaaacacatcaagaatgtgctcgaacataattgttccacaatatcg
gctccgagttttgtcagcgagaagaagaacgtaatagtggaatttagttcgcccaatatc
gcaaaaccctttcacatgggacatctgagatctacaattgttggcaattacattgccaat
atcaacagctttgtgaaaaataatgtcaagagaataaattacttaggcgattggggcact
cagtacggtttgatccaactcggagttgatatggcaagtattcacgaggacgagatgaaa
aacaatcccataaaatccttgtacacggcatacgttaccgccaacaagttggccgaaacc
gattcctcggtgttgcaacgtgcgagagaaatattcaaggatctcgagaccggcacggga
gttacatttgaacagtggaaaatgttcaaacaatatacggtcgaagaattaaagagaact
tacggtagaattgggattacgtttgacgagtatcattgggagtcgatgtacaacgcgaga
aaaatagaaaaaataatcgcaatgatggaagacatgcaattactagtgacggatgaactg
aacagaaaagttgtgaatctggaaaacgaaaagagcgttcccgtaataaagagcgacggc
tccactttgtacatagctagagatatcgccgcggccatcgataggtttgagaagaacaat
tttgatcgcatgtattacgtggttgacaacgcgcagatcaattatttttcaaacttgctg
gagatattgagacgaatgaaaatgccgtgggttgacagactgagacacgtgcagttcggc
cgattaaacgggctgcgtacgagaaagggaaacatcacgtttctggaagagattttggac
accgccagagatgtcatgaaacagaaacaaatagattcatccaccactaaagttcgttta
gactcgacagataacagctcggacatactaggtatctctgcgatgattgttaacgattta
aaaagaagacgacaacgagattacacattcgactggaacgcagcgtttgatttgaaagga
gacactggggtaaaactgcagtacgcacattgtcgactcgtcaatctggagcgcaactgc
ggcgccgtcttggtttcggaatgcgaaccgagtcttctgcgagaggaagttgttgatgac
ctggtcatattaatttccaatttcgaagaagtggtgttgaggtcgtacgaagaaatggaa
tcgtgtgttttaacagcgtatcttttcaatttaacacgtgcaattaacagagctttcaaa
acgttgagggtgaaaaacgaagcgcccgatgtcgctagtcagaggttgctcctgtttcac
gtctctaaaaatgttcttgcacaaggtatgaaactacttggtctaatgcctctggaagaa
atgtag

DBGET integrated database retrieval system