KEGG   Pseudomyrmex gracilis: 109855091Help
Entry
109855091         CDS       T05003                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00670  One carbon pool by folate
pgc00790  Folate biosynthesis
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109855091
   00670 One carbon pool by folate
    109855091
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     109855091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 109855091
NCBI-ProteinID: XP_020284523
Position
Unknown
AA seq 180 aa AA seqDB search
MIPKVELIAAACENMGIGINGNLPWRLKSEMSFFTRMTTSTIDKDKKNVVLIGRRTWDSI
PEKYRPLKDRINMILTSQSLNYGDKVITCKSLLHAFEIIAKMQNQIERVWVIGGSSVYKS
AMESPHFKRLYLTRIKKEFECDTFFPPIPNDLVLVRDPAVPQGIQEENGIEFIYEVYERQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgatacctaaagtagaattgatcgctgcagcatgtgaaaatatgggtattggaataaac
ggtaatttgccctggcgtttaaagagtgaaatgtcgtttttcactcgcatgacaacaagt
acgatagacaaagataaaaagaatgtcgtacttatagggcgacgcacatgggatagcatc
cctgaaaagtaccggcctctaaaagatcgcattaatatgattttaacatcacaatcattg
aattacggagacaaagtgataacatgtaaaagtttattacatgcttttgagataattgca
aaaatgcagaatcaaatagaaagggtatgggttataggaggaagtagtgtatacaagagc
gccatggaatcaccacacttcaagcgattgtatctaacacgtataaagaaagaatttgaa
tgtgatacattttttccacctattccaaatgatcttgtgttagtgcgagacccagctgta
ccacaaggtatacaagaagaaaatggaattgagtttatatatgaagtatatgaaagacaa
taa

DBGET integrated database retrieval system