KEGG   Pseudomyrmex gracilis: 109856951Help
Entry
109856951         CDS       T05003                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pgc  Pseudomyrmex gracilis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pgc01002]
    109856951
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgc04147]
    109856951
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109856951
Peptidases [BR:pgc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109856951
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109856951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 109856951
NCBI-ProteinID: XP_020288326
Position
Unknown
AA seq 359 aa AA seqDB search
MKSSYLLIAAILPFAILEIWYTGICVIWTMKVSVLIYLIIFGLIPVIFHYSQTLQRKILF
LNFVQWPLKVEFSNPKSVGLEGARNFYLYTDQQVKIGAWQILPKSLLNNTIPATDEAYET
LLSNAKQPVFLYMHGNSGNRASSHRVELYKLFQDLDYHVICFDYRSYGDSDELDLSEEGI
VMDSKYVLEWVMKKVNNSAPVFVWGHSLGTGVSTHMLALLAAENIQPTALFLEAPFNNMA
DELTEHPLAQLFKHLPWFHWLIVEPFYNNNLRFESDKHISKIECPVMILHAEDDGVIPVY
LAEKLYQAAIDSHGNDTNHIQMIKIDSSYGLGHKYICRYKELPSIIKTFVAKTNRNQIE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaagttatctactcatagcagcaatattaccattcgccatccttgagatttgg
tacacaggaatatgtgtgatttggacaatgaaggtgtctgtattgatatatctcattata
ttcggactcattcctgtaatttttcattattcccaaacgttacaaagaaagatactcttt
ttaaattttgtgcaatggccacttaaagtggagttttccaatccaaaatcggttggattg
gaaggcgctaggaatttttatctatataccgatcaacaagtgaaaataggtgcttggcag
atactgcccaagtctttattaaataatactattcctgcgacagatgaagcatacgaaaca
cttttaagcaatgccaaacaaccagtattcctatacatgcatggcaacagcggtaatcga
gcaagttcgcatagagttgaactttacaagctttttcaagatttggattaccatgtgata
tgttttgattatagaagttacggtgatagcgatgaacttgacctttctgaagaaggaata
gtcatggacagtaagtacgttcttgaatgggtgatgaaaaaagttaacaattcagctcca
gtttttgtctggggccactctttaggaactggagtttctacacatatgttagctctgctt
gcagctgaaaatatacaaccgacagcattgtttctggaagcgccttttaataacatggcg
gatgaattaacagaacatccactcgcacagttatttaagcatttaccgtggtttcattgg
ttgatcgtcgaacctttttataacaataatctacgatttgaatctgacaaacatatctcg
aagatcgaatgtcccgttatgatattacatgctgaagacgatggtgtgattccagtctat
ttggcggaaaaactttatcaagcagcaatagatagtcatggaaatgatacaaatcatata
caaatgataaaaatagattcgtcttatggacttggacataagtacatttgtaggtacaaa
gaattgcccagtataatcaagacgtttgttgctaaaacaaacagaaatcaaattgaataa

DBGET integrated database retrieval system