KEGG   Pseudomyrmex gracilis: 109857771Help
Entry
109857771         CDS       T05003                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00970  Aminoacyl-tRNA biosynthesis
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109857771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pgc03029]
    109857771
Enzymes [BR:pgc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     109857771
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     109857771
Mitochondrial biogenesis [BR:pgc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109857771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 109857771
NCBI-ProteinID: XP_020290031
Position
Unknown
AA seq 159 aa AA seqDB search
MDGLWRFQRSFNKNIVTSLYRFTALLPRTFSVSTIRASQQQQQQQESIENNCNNRPDKKK
VAIDEATIRKIENLALVGFEYEHSKRVLEEAIAFAERLRKVHIDESVRPLYSTLENDFIR
LREDVARNDVSRKEILKNAAVLEEEYFVAPSKGSNTDSG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggacggattgtggcgatttcagcgatcattcaacaagaatatcgttacttctctttat
cggtttaccgcacttttacccagaacattttctgtttcgacaatacgagcaagtcaacaa
caacaacaacaacaagaatcgatagagaacaactgcaacaatcggccggacaagaaaaaa
gtcgcaattgacgaggcaacaatcagaaaaatcgaaaacctggcgctggttggtttcgag
tacgagcacagcaaacgcgttctggaagaagcgatagcgtttgccgagcgattgagaaag
gtacatatcgacgagtcggtgcgtccgctttacagcactctggagaacgattttatccga
ttgcgagaggacgttgcgcgaaacgatgttagtcggaaagagatattgaagaacgccgcg
gtgctagaagaggagtactttgtagcgccttcgaaagggagcaacaccgattcaggatga

DBGET integrated database retrieval system