KEGG   Pseudomyrmex gracilis: 109857787Help
Entry
109857787         CDS       T05003                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1-like
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00051  Fructose and mannose metabolism
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    109857787
Enzymes [BR:pgc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     109857787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 109857787
NCBI-ProteinID: XP_020290068
Position
Unknown
AA seq 443 aa AA seqDB search
MIVATIVDINVQDIRFPTSENKDGSDAMHTDPDYSCAYVTITTDQGFKGYGLTFTLGRGT
EIVALACKSLFTFVKGLTTTEIYYNFASFWRKLTSDSQLRWIGPEKGVIHLATAAIVNAL
WDLWARIEDKPVWKLLADMTPDELISVIDFRYIEDLITPEEAKIILEQNRENRKYKESDL
KRRGYPAYTTDVAWLGYTNEQVEELCRKYLHEGFTGFKIKVGQNLENDIVRCSIVRRAIG
YGNKLMVDANQVWWNVSEAVEWMKKLQPYKPYWIEEPTSPDDILAHGEIRQELHAINIKV
ATGEMCANRVMFKQFMLFKAIDVCQIDAARVGGINELLAIYLMAYVKNIPVCPHAGGVGL
CEMVQHLQMWDYICLSQTQEERMIEYVNQQHSQFENPVKIENGYYMPPLEAGYSTKFKDD
SIKDYIYPDGDYWKQRLSKQEIK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgatagtcgcgacaatagtcgatataaatgtgcaagatataagatttccgacatctgaa
aacaaggatggaagcgatgcaatgcatactgatccagattactcttgcgcatacgtaaca
attacaacagaccaagggtttaaaggatatggcctcacatttactttaggaagaggaaca
gaaattgtggcactagcatgtaaatctttatttacattcgtaaaaggtctaacaacaacg
gaaatttactataactttgcctcattttggagaaagttaacaagcgattcgcagttgaga
tggatcggaccggaaaaaggtgtgatacatttagcaaccgcagctattgtaaacgcattg
tgggatttatgggcgcgcattgaagataaaccagtttggaaacttcttgcagacatgaca
cccgatgagctgatttctgttattgatttcagatacatcgaggatttaataaccccagaa
gaggcgaagataatacttgagcaaaatcgagaaaacagaaaatacaaagagagtgatcta
aaaagaagaggatatcccgcgtacacgactgacgtcgcatggttaggctacaccaacgaa
caggttgaagagctctgcagaaaatatttacacgaaggtttcacagggttcaagataaaa
gtcggtcagaatctcgaaaacgatatcgtaagatgctcaatagtgcgtcgtgcgattggt
tacggcaataaattgatggtagatgcgaatcaagtgtggtggaatgtgagtgaagcggta
gaatggatgaaaaagctacaaccgtacaaaccttattggatagaagaacctacatctccc
gacgacattctcgcacacggtgaaattcggcaagaattacacgctatcaatatcaaagta
gctaccggcgagatgtgcgcaaatcgtgttatgttcaagcaatttatgctatttaaagca
atagacgtttgccaaatcgatgctgcaagagttggcggaattaatgaactcttggctata
tacctcatggcatatgtgaaaaatatacccgtgtgtccgcatgccggtggagtaggtttg
tgcgagatggtccagcatctccaaatgtgggattacatctgtttaagtcaaacacaagaa
gagcgaatgatagaatacgtgaaccaacagcattcacagtttgaaaatccagtcaaaatt
gagaatggttattatatgccgcccttagaagcaggatattcgaccaagttcaaagatgat
tctatcaaagattacatctatccagatggtgactactggaaacaaagattgagcaaacag
gaaattaaataa

DBGET integrated database retrieval system