KEGG   Pseudomyrmex gracilis: 109859540Help
Entry
109859540         CDS       T05003                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform X1
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00510  N-Glycan biosynthesis
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109859540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgc01003]
    109859540
Enzymes [BR:pgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     109859540
Glycosyltransferases [BR:pgc01003]
 Glycan extension
  N-Glycan
   109859540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 109859540
NCBI-ProteinID: XP_020293474
Position
Unknown
AA seq 586 aa AA seqDB search
MKGKAQESTIHGFAKQYPGCTLYTRKKSGGVVVVGGSRSGRGILLRTIVFVFLATFLWLQ
LHVISLTGRDDSGQFSSNETLFSLVPQELHRFLKEGRNSTGLVNASSGALTELEIAEIRR
KIERANEEQKVYNEEAFGPLASDAPIIVIQVHTRLTYLRHLIVSLAQAKDIEQALLVFSH
DIWHPDINYLVQSVDFCRVMQIFYPHSIQTHPRTFPGEGPNDCPRNIRKEQALNLKCTNA
KHPDLYGHYREAKFTQTKHHWWWKANRVFDQLSVTRNHTGMVLFLEEDHYVAEDFLHVLR
LMERTCKLNCERCNVLSLGTYLKTYNYFADFSRKFLGVDSALQKEMLRGLKRQEARVMQR
QQIGNGELDGANHANSAPGISNGSIGGSGGRGNGGASSTYYQNANMVQAAPAWAFQLLPS
LYNHYQKAEVTPWISSKHNMGMAFNRVTWNKLRKCAAQFCSYDDYNWDWSLQYIAQTCLP
PSRGAGIAPRAESGLITMTMRAPRVFHIGECGVHHKKDNCESTAVIAKVQNVLKSARNHL
FPSQLTLTIAGTAKKTKLRKGNGGWGDVRDHQLCWNMTVQPDLVLP
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaagctcaagagtcgaccatacatggctttgcgaagcagtatcccggctgc
acattgtataccagaaaaaaatcgggaggagtggttgtcgttggagggtcgagatcaggt
cgcgggattttattgaggacaatcgtattcgtcttcctggctacgtttctctggcttcag
cttcacgtgatcagtttgacgggtcgagatgattccggacagttctcgtcgaacgaaacc
cttttctctctggtacctcaggaattgcataggtttctcaaagagggacgtaactcgacg
ggtctggtgaacgccagctcgggagcgctcacggaattggagatcgcagagatccggcgt
aaaatcgagagggcgaatgaggaacaaaaagtgtataatgaggaggcgtttgggccgttg
gccagcgacgctccgattatagtcatccaagtgcacacgcgactcacttatctgcggcac
cttatcgtgtcgctggctcaggccaaagatattgaacaggcccttctggtgttcagccat
gacatttggcacccagatatcaattatctcgtccagagcgtcgatttctgccgggttatg
cagatattctacccgcacagcatacagacacatccgcgcacatttcccggcgaaggaccc
aacgattgcccgcgaaatattcgcaaggagcaagccttaaacttaaagtgcaccaacgcc
aagcacccggatttgtacggccattacagggaagctaaattcacgcagacgaagcaccac
tggtggtggaaagcgaatcgggtattcgatcagttatcggtcacgagaaatcacacggga
atggtgcttttcctcgaggaggatcattacgtcgcggaagattttctgcacgtgctcaga
ctcatggaacgcacttgcaagctcaattgcgagagatgcaacgttctgtcgttgggtaca
tatttaaagacgtacaactattttgcggattttagtcgtaagtttctcggcgtcgatagc
gctctgcagaaggagatgctgcgcggactaaagcggcaggaggcgagggtgatgcagaga
cagcagatcggcaacggggaactcgacggcgccaatcacgccaactccgctcccgggatc
agtaacggaagtatcggcggcagtggtggccgaggaaacggcggcgcgtcctccacctac
tatcaaaacgctaacatggtgcaagcggcgcccgcatgggccttccaactcctgcccagt
ctctacaatcactatcagaaggcggaagtgacaccttggatatctagcaagcacaacatg
ggcatggcgttcaatcgcgttacgtggaacaagctgcgaaaatgcgccgcgcagttttgc
tcgtacgacgattataattgggactggagtctgcagtacatcgcgcagacctgtctaccg
cccagcagaggtgccggaatagcgcctcgcgccgagtcgggattgatcaccatgacaatg
agagctccgagagtcttccatatcggcgaatgtggagtgcatcacaaaaaggacaattgt
gaatcgacagcagtgatagcgaaagttcaaaatgttcttaaatcggcgcgcaatcatctg
tttccctcgcaattgacgttaacaatcgccggaacggcgaagaagacgaagctccgaaag
ggcaacggcggttggggtgacgttcgagatcatcaactctgctggaacatgactgtccag
ccggatctagtcttgccttga

DBGET integrated database retrieval system