KEGG   Pseudomyrmex gracilis: 109859603Help
Entry
109859603         CDS       T05003                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00350  Tyrosine metabolism
pgc01100  Metabolic pathways
Module
pgc_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109859603
Enzymes [BR:pgc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     109859603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 109859603
NCBI-ProteinID: XP_020293581
Position
Unknown
AA seq 217 aa AA seqDB search
MSVMGKPVLYSYWRSSCSWRVRIALNLKEIPYDIKPVSLVKSGGEQHSNEFREINPMEQV
PALHIDNHTLIESLNILQYLEETRPNRPLMPADPVKRARVREICEVIASGIQPLQNLVVL
IYVGEERKKEWAQHWITRGFTAVEKLLSSSAGKYCVGDEITLADCCLVPQIFNARRFHVD
LRPFPTILRVDRHLEHHPAFTAAHPNNQPDCPPEATK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgatgggtaagccagtactttactcttattggcggagttcctgttcgtggaga
gtaagaatcgcattaaatctgaaagaaataccgtacgacataaagcctgtgagtttggta
aaaagcggcggtgagcaacattccaatgagtttcgcgagattaatccaatggagcaagtt
cctgcgctccacattgacaatcacacactgatagagtctctaaatattctgcaatacttg
gaagagactaggccaaatcgtccgctgatgccagcggatcctgttaaaagagccagagtg
agagagatatgtgaagtaatcgccagcggcatacaaccactccaaaatctcgtagtttta
atttatgtcggggaagaacgtaagaaagaatgggcgcagcattggatcaccagaggattc
acggccgtcgagaagttgttgtcgtcgagtgcgggcaaatattgcgtcggtgacgagatt
acgttggcggactgttgcctggtcccacagatattcaatgcgcgaaggtttcacgtcgat
ttgagaccattccctacgattctcagggtcgatcgtcatctagaacaccatcctgccttc
accgcggctcatcccaataaccagcccgattgtccgcccgaggcgaccaagtag

DBGET integrated database retrieval system