KEGG   Pseudomyrmex gracilis: 109859760Help
Entry
109859760         CDS       T05003                                 

Definition
(RefSeq) titin-like isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
pgc  Pseudomyrmex gracilis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pgc01001]
    109859760
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pgc04131]
    109859760
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pgc04812]
    109859760
   04147 Exosome [BR:pgc04147]
    109859760
Enzymes [BR:pgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109859760
Protein kinases [BR:pgc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109859760
Membrane trafficking [BR:pgc04131]
 Others
  Actin-binding proteins
   Others
    109859760
Cytoskeleton proteins [BR:pgc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     109859760
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109859760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C2-set_2 C1-set BiPBP_C Ig_4 Spectrin GF_recep_IV
Motif
Other DBs
NCBI-GeneID: 109859760
NCBI-ProteinID: XP_020293891
Position
Unknown
AA seq 11401 aa AA seqDB search
MAEIPDESSLHIRSHSAQNVEATNKDSNKEVADKSYSESATEEYNVECYTTATECSTPLP
ISRSESFVTSPECEDLFTTAPVVTPSCSSSTWITGTPKLTTTTAPHYSGTSNETQTMKPT
EVMSNISSSISGTQPTTRIKTMDKITDERSGKIAKEVTETTVLRVSHNVRLDVASYKVTS
NTVLDHRQHIDGKVIQDIESVIPAESHEKTDGVHQDSDVSLFKESEKCVAKCPKNVQSDQ
NVTTKFTNKVNESSRSNLKEYEDISLFSQELSRHHEDSGIDMSPIKKDDNLEDDEFLEKA
RKSGEWLKLKILELQPELTKLGASVKEATEFSNAHEQVLLRLQNKQNPVEELLRQADHLI
ATQQTKAEVYAAMAESLGQAWRDVNQLLERRKEILDQNVLFQRRAAECRENMDALEMACN
DTLLPIEIEAVRNFLSKIQDLRKDMLEALMGALREGKTLLDRLKELANEGTIDSRPDRVK
DDANHAMLLVERWLEELHDRRRLIETSFRSRKTQLEQCLALALLATDLRDLEELLNDRIA
ALAGTCDQLGDSASNAEMLLFELKKLQAEAKDFQDRAIKITKSTERLVSSGHFAGEQATE
QAYAILSVAADYVNDLDQYSTLLNKAMAFFESARSALTKLDQLEIQLMTTEHPPYSARLA
RFHAQTVATIEDVTAKPLAEGYALLDVTGRGAPGAEGVRNTIKELENRKTSLIERCTAHK
EENLEISRMLATFLDKHEALRAWLTSVVEAFLQGHQDMGSDLAMARDFRRVHCQLLIDLE
NKSEEVDHLELEILPVVERLEETQKYELRSKIKNLKDEWTKIKIALVKRIELGTTYIQFH
EIVEELTNEMDFITDELKKCEGVLNEAKINELEKKWTSLEPLYKKLDDHAKAFLDETDNV
DDPYLDVSRACLCVQTLLEKFANRQLVVTESWEKWQTTIEITRQRRIECKRKIEESAKTL
AWISQLETTLYPVITTPFSRIIDILENLKDVKQRILPELNKALQELDTRKKNIKVFVERD
NAEAAEQVSNKLVQTYEKTYTVTKDYEILLESLISIFKNLEEVENKICQTKRESECVSNF
TRSIDVDGALSELDILKTFITKFLQQIRTKSEDIIDSIRRQEPPESATQDIEKLKRAIHS
VVVEYERFQTETTSCLEKHRRLCIFREDLEKINSDLRELNDQLKNVDEKLGNNLSASKTA
LASFEQFEQTLTTLEEKIEIFVKEAEETIVPSPPQVTDEILSLRNRFDHLRQYVRDIKKR
MNLSIEYFVLLEEAKQWFREGSKLLVIVARKATSVKVPEETVDLLREIEAYLKPGEEQQE
KRIEKLKQLSTIVFGTDRLPQFQEVVGENRQMLDSFAVISSELRTLSQNLQTAEDLKEKL
QAEQLEVDQKLQAVKIEMAAAEAARKEAENAKKLAEQLAAETLDKAAIEARRLKEEEARK
LVSPVSHSVSAQTETIVEETVTSAVTTKEIHILQKTEVEKSVPVVQKEVSPPRTLVFEEI
QEKSRTEDLKADKLVSLAPEFTVLLNDATVEEGKEFNFECHLIGQPTPEIVWYKDGISIL
NNPDYLTTYLNGVCVLKIEETFAEDSAKYTCRAFNILGSAETSAILTVKETAAEEQPSGP
VFVKELQPSTVREGSAHTLECTVEGNPLPTVQWYKNDVNIDNSPDYVITFNNGEAILKFD
EVFLEDKGLYTCKATNRWGQSSTTASLDVEPAQISMKKPYFVVPLSNAMARAGQRVKLEC
EAGGDPIPELSWSHDGKQLEETRYHKIQTDGARTSLTITEAFPKDAGSYSVTAKNEVGEA
TASCTVSVKGRLVHETSESDFVCSDTEPIVPKFQVPLRDLKIQEGRSARLDCVIVGQPEP
EVIWYHDDQPVKESSDFQLLFQGDRCSLVIHEAFLDDAGMYKVVAINSGGEASSQCTLTV
TPASHISDVQKEEETLVSGSPPKFVRLPTDLLVAEGEDAFFECAVTGQPKPDLRWYSDDC
EVTRKERILIEEKEDGTRILKILSTTPEDKGNYVAKAINAHGEAKAFARLVVRSLGDFKR
NEELVQMEEKLIQPTFKEVFKDRTVPEGASTKFECIVTGKPSPKIQWLFNDQPVHGKDFL
VSVSGDRQVLAIPEVGNAHIGTISCVAENAAGRAICSAKVEISSGFEQQTIDEIERVLEI
VPQSPAEIMHPASSSEKHFSSEKTYHEGGSESQVLTKMSSSVTHSSTTSMKKEFISSTMT
SSQSGQEPSSVCTKTTVQSSEQSTSENGAPPVVQSHKIQEFEKIIQEQPKEMRQEKTVIV
SEETDSAKRDVKTSQVQKPSRKSTAPRFVSPITGMIVDQGSDVVLEGIIDGFPQPTVTWS
KNGQELTSKDNIKISYAHNHVKLELKNASVKDAGRYTCMVNNDVGSASSTADLVVKKTIF
PPVFGKRLKAQVVKKGDRVIMEVEITGIPDPTVSWYKNDVPISERPPELRIIHQGNCYTL
IIDKAKEEDAGKYMVRATNAGGEAQSIADVAVFDPKPETMIEEHRTVIYDDVQGKSVVQS
EGKKEEISTSGILMSETPIATFLPSAFKPVTTLMSTTFDTVKKIEQPEITATKSEKISSI
IESHESETKSEQKFHMKLEHKTPSIVEMKSPIEQTIAVKELDRDKKDIMESFTKIKEETI
ENENIETSRIAKKDALSFFESMTKETEIIPKKPKEMIKLTEDGQAQEAKVGKLAQSYERV
STQEVKKPESRPLEFQTTKKTMQDIFTKFEQGSSPRGVENKLFEFPYESPKVETKKTIVE
EMITSGSSISELQIQTESSETLMKSFNLVPEPPPEICYMPKPEELRKKRPDISVKAKQLQ
ESFEKTISPIDAPIGGVKIFPTSLSKTPESAPVRPVKITEPTLVCTIPPPFELEKKEMLE
EICVKKDAHEKKESKYFKEEKTEPFRYTSMSTSIVRSASPTRPWSSSSDVETKSHVSTDL
SEYRCHSAASSHQEILRSSSPRPSADGLAMEKSWAKKCADSNRKSWPPPSDSAQKWNVPV
DEYKSSTKEFKQKVEETPQGVKKISTESSASVEKRSWSSKEEFTEKIVEKTPPARLGPII
YNAETIKVDHTVNTMQEKSLYEKYMSECNVEKAETMQKFEEFGSKQWTDGKELKAPSLVK
KVEPLAKPLVTPSLVQTEIDSIILKPGSPPEIGYVPPPIKETTMIEQKEIDSIVLKPGSP
PEIGYVPPPIKEKTVIERTEMDSIVIKPESSPKIAYIPPPIKEKTVIEHVAKVEKKIESP
VRITPPPVLPPKDMRITPPPVPAKKPAKVSTPMPSKFVKSSFGHESDYESDFEGRLKAKW
RPYESDNEEPHYRRVKAPVLKQPTRPRSTEPEPLPPSQFETPTPFTGLSKSLVTTESTEK
IIKKTAVKRHEKEFKQQQQQEQTSIPLKPGSPPIYVQPATKSSAPRSPSAKKPESPKFKT
KVFQQESGYMADTDEPFQQKISSTTMQKSYGKRDGSSTFHTESRTTCTESKTKIFETRSY
ESDQFRKEESFVSPSISSVQTSPKVAQQQRSSFEKSYASSTSSGLHKFDSVKETEKILPT
SPSPSRFVKGDFRESDYESDYDGKTSSCRTVSSSKLTSITDSGKQTESTLHRKQFTPTKP
KTVLLPGSPPELAYAPPQPQQQQQQQQQQFYEARTSMPFTNAVGTETKKTVRMDESTKNA
RRIVTVEQTSRVIKFGDTNATSQKQHYRVPVPKKFVQGQFRESDYESDVDSKIRPKWAPP
DSDTEEPHYRRVQPPAAKSLRSSSAPVRQTHVASPMEFDTGPSVTQVRQEDTDKKIDQRY
QQQTTSEKIDLQPGSPPEYGFVSRSDVKKAADHIATRHMSDMTSSFKSKTEKFVTDIQSD
LRQSKPILKHPVESRTTDTDEPRTYREESRVSEHGTKQIDPDTGLIYFKYDFGYEFGIVL
PGEGKKTVESSKKTIQGQRRASDVEVPIVHEFTEKKTNGFAKRNTFPSRQSKPGSKFGCS
KTVKWEPTSESEFSEAEDTRSLSKKPSSLDNSMAPPSLIIPSSVSPSRWDRVTLSPLSLS
PSLPSLSPRHSSATGPPSNVDSAGSPWPTSNGVSSGKEVIQPYLDILPKKAPTFITPLKD
IAVVSGQPARFECIVQAEPQPNILWSKDRRIVENSTNHDVQYRNGVCRLTIMRASPEDAG
TYACTATNSLGSTVTSANLEVPGASSISDTYRDHKKCTVEQFPQDSQRYVALRDLFFSQD
KPRILTNHERLYKSLYDFGLSDSFVDANNHENEGNRFDNYIKREWSAIYARNGIGDSRLN
VKRSLHNLTGTCNIEHVQGEIVMQSTPTVPTFTGRPGDPSPPIFERIFKNARFAQGGNAI
FEGCVRGNPKPTVSWTHKGTPLLESRKIRMSYDENTGIVTLQINQIGPGDEGEYTCSAKN
QYGEAICSVYIQPEGFGPPAQQPTDSYRKEFTQSYQTSEQKMQTGSQMFQQRSYQQSIDK
RSYVNGTTTSIEDFKVDTFEYRLLRETEYRESITRRFAGESDSQISTMIDRTLGPVAPPQ
ITQKPRNSKLVEGSDAVFTAKITGNPKPRLTWFKNGQRIRDSQRVETSYSNQQATLRIRV
ALPEDSGHYTLLSENPQGCTVSSAYLAIESSDQVDQVPYQAQREFIKTQQVESTSESADS
GKVLPPNFVRTITDREATEGKMTRFDCRVTGRPYPEVTWYINGQQVANDLTHKILVNESG
NNSLMITNVSRFDAGVVTCIARNKAGETSCQCNLNVIEKEQVIAPKFVERFVTTSVKEGE
PVTFMARAVGTPIPRITWQKDGVPITPGSEIRISSDGSGASSLDISCAKFSDAAWYQCTA
QNVAGSTATRARLFVETPKGTAPEPRRLNLPRPTKIIEPEPAPGPEVIYLRHVERAKPYL
PPPEEDTIYPPPRFIIPLKDLYQIEGGRIHFEARIEPVGDPTMRVEWYVNGRALDASSRA
TSIFRFGFISLDLISIVLQDSGEYFCRVVSSTGVAESRATLSVTPRATIEQTSQHPDSLQ
YIQQLEDYSKYQRQESVEETSSQRPVFIRPLQDLGELQEGRNAHFEAQLTPVSDPTMKVE
WYKDGKPITASSRITNIFNFGYVSLNIMHLRAEDAGSYTVRAVNRLGEAISSATLRVFAR
TSVTTDLGIPEQMRYIEAAEELEAYQQAMHQKYVQEQPEPSSPPEFKSPIKDQSSIREGG
FAHFEARLEPVGDSNLRVEWLKDGRPVEASSRITTFFNFGYVALTIKYVTIHDVGVYTCR
AYNRVGEAHTNAQLSVISKDDVIYDSQHPTGLQKIQTLEDSSRYSRQVQEETQVTQAPRF
LGNLKGTNKIVEGQRAHFEARVEPQSDLSMTIEWYHNGKPITAANRIQTYHDFGYVAIDI
LQVRSEDAGTYTVVARNSRGEARLSATMIVETRSSIDTSSMHRGTYEKTQRLEESKFVEP
QYHIEEISKSKPIFIQPLSDPKPVSEGKNIHLECRLEPMGDPTMRVEWFQNGRPVTVGSR
FRTYYDFGFVALDIVHATAYDSGEYTVRATNHLGTAHTSACVRVIGRSDIVTDTQNEQSL
EQIQMLEDSSRYRRTQQEEVTVMQAPQFTRPLHNIETVELTNVHLECRLQPVGDATMKVD
WFVNGRPVKTGHRFRPSYEFDYVALDILGVYPEDSGVYTCQARNQLGEAVTSCSVRVHAK
KDLLLESQHPEGLERIQYLEDASRYKRHELVDEVVNVKPRFITKPKNQENLREGQHAHFE
CKLEPVTDSNLKVEWFKNGRPVTIGHRFRPIHDFGYVALDVIDLIAEDSGTYTCRAVNLV
GSDEVTCILTCRSSAQILTDTQNELGLEQIHYLEDRSKYQRKEFVEETTTQAPIFTTSLN
NVEIKEGQRAHFECRLIPVSDATMKIEWFHNNKPVKAGSRFVETNSFGFVALDIMYAYPE
DSGTYTCRARNIIGEAITSATAIVHSKKSIYTETQNEETLQRLRSLEDTSRYQRKTTTEE
IITQAPVFTMPIKDLRVAENQAAHFEARIIPVGDPKLKVEWLRNGVSISASNRVTTMHDF
GYVALNMKYVNPEDSGTYTCRATNELGEAVTSATLFVQSKAALQFESQHESALSKLQALE
DTSKYQRREEEEIVVKDKPSFTVQLNGPTSLVEGQSAHYECRIEPYPDPNMKVEWFHNGK
PLSTGHRYRTTCDFGFASLDVLTVYAEDSGTYTCRATNKLGSAQSSINLSVKSRASIIHD
TQHESALKKIQYLEDDSRYKRVVEEDTIIAEKPTFGRPLKNIEHLPEGKSAHLEATLTPV
NDPTMVVEWFRNGRPIPQGHKFKTTYDFGYVALDILYAYPEDSGTYMCKAKNAVGEAVTT
CVITVDSKQGLYLDTLDAQRLQKIRELETVEIKEEVEKEVIHQKPVFLTPLNNLDHLKEG
EHAHLECRVEPINDPNLKIEWFVNGVAIKTGHRFRTTHDFGYVALDILYTYPEDSGTYMC
KATNLAGEAVNTCTIKVSSRRSILLDTQHPDGLEKIRELEAHGHPARLEVEEPPVTPPRF
ITELRGTTEVYEGQTAHFECQVEPLHDANLRIEFFHNEKPLPSAARFHVTFDFGYVALDI
GHAVPEDAGQYSVRAINALGQCVSSIELKVIPRDNIILDSQRPEGMDKIRELESQQPWKR
PEIPEPQTRQRPVFTQPLQNIDSIAEGHTAHFECRLIPVGDPMLKVEWFRNEVPLETSSR
ITKVHDFGYVSLDIAHVREEDEGVYMCRASNPLGEAVTTASMKIKSKASIQLETQHPEAQ
RRIAQLEAKEVERPEEPEKVFDKPIFTQLLTGPTELWEGQMARYECRVVPVGDASLRFEW
YLNGVELKMGSRFHTNHDFGYVTLDILKVISEDSGVYTCKAINKAGEAVSSISLKVKARS
AIDSDSIQANAWQKIQLKEAEMNKVPEMFIDTTPQQAPVFTKHLESYDKLVEGQHVYLEA
QVEPRADPNLRVEWFKNGVALQTGTRLRSTFDFGLVTLSINSLRADDSAIYTCKATNLLG
EAVSTCSLKITDRHWLLGDTLHPDALPKIDALEQPQVTSTEQPEPIYEEPVFITHLNNVE
CIEGDNAHFECNVEPSKDPTMKIEWFLNSKPLPTGARFKSTYDFGYVALDLTHAYEEDSG
IITVKATNSKGSAQTSGTLKCTSKQNIYLQTQHPQGEAGLEKVKEAEDAFLSKYRRPDEA
PEHEYPKPIWTVPLQPEFKLGESEPLHLEGQVEPKDDPNLKIEWYFNGKPLEHGSRFKMT
SDFGFVTLDLTDVYERDSGIYTCKAYNKAGEAFTSTTIYCSTKENIIEKSQHPKGKEGLE
AIQDLEESLKRQEGVAPGEEEGQPPQFTSQFENLTNLSEGEIAHFEASLIPTGDQTMVVE
WFYNGKSLEASHRTRTVYAFGMVVLEVLGTKIEDSGTYTCRATNKWGKAEISVQLECIDK
SKGQKPKFTTHIQSLEGLKDGQSAHFECTLIPVGDPCMKVEWFHNGKPLRHSSRFKMVSD
FGFVVMDIAGVMSHDTGEYVCKASNKYGEDYTKATIKCFGKSGVYLDSLQPDSLARIREL
ESYSGEQPTTPTTPVAEPPKFITQISDITKLVEGQSAHFEARLTPVNDPDLKVEWYYNGK
KLPHGHRYRTFHDFGIVILDILYCYEENSGVYECRAVNKYGEDSTKATLKCFSKTNLVLE
SQLPKGMEGGLEKIQTLEDSMIRTRDEKTVEERGKAPVFTVPLSNIDGLREGESAHFEAR
LIPTDDPKLKVEWFWNGKPLRTGSRFRTFCDFGFVILEISPIYPEDSGEYSCRATNDYGE
AVTTCTMKCTGKRSIILESQLPKGMESTIDKIAELEGLGNVPGQASPEDDTGRPPEFITT
PSDLTLAENSLAHFECRLQPINDSSMRVEWFHNGKPLLAGSRIKTIHDFGFVILEVANCY
QRDSGLYTCKATNRHGEATVSCKLQVRGRQGIILEPQLPSNFKTGTESIQKLEESLYKRD
EILAEEEKPNPPRFTVELKDIEVEEGGSSHFDCRVEPVGDSTMRIDWFHNSRPFATGSRV
HQINDFGFISLDMSYTYARDSGEYVCRATNKWGSATTKATITCKSKKTIDFDSQLPSGMS
GEKLKELERGPVSEAPKEEAPRQPPRFITQIESATIDEGEPVRFECRVEPKEDPNLRIEW
YRNGKLIPAGHRYRSVYDMGFVSMDILYVYPEDSGEYVCKAINDLGEDTTRAAVSCKKLP
SIILQNQVPKGMKKSEALMQMEATIKKYTSEVHLTEDDLYDADKKQPPRFVTQIQDQTDL
VEMNSTKFECQLAPVGDPNMKVEWFFNGKPLPHKNRFTPIYDFGYVAMNFGWVYPEDSGE
YLCRATNLYGMDETRAIIRTAGKPGIIYESQLPKGMKSIEKIREMEAAWQIVPEEEGEEE
KVRSAPVFVSKPEPVTVEEGDWSRFCCRVTGHPRPRVMWIINGHTVVNGSRYKLTYDGMY
HLDIPKTRQYDHGKVEVIARSSVGEARTETTLTVKQRSDDYRGVLKNSPRPWYDYGLTQY
QTERQNTELERVFDERHQSVSQGVEIATEHLAPKVIKEPETEWQKSVKSKKNEVYYNKLM
SLEEDQILKETRLRESSHQFAIPGDKVVANSLAKGMAQKYEESLEEQPQQPPQTPPTTKY
VKKPFVTEVDIDTERVKATGKYPPEPSESTVHGREVHVAKQKQTQKEIKGDLEITRKITA
TETTEVEHKAKTQERVVQGQVKPAKPPVFTKKIQPCRAFEQEQAKFEVEFDGDPLPTIKW
YREDFPIQNSADLQIYTFSTKSVLIIRQVFMEDSGVFSVIAENRGGKAKCSANLVVEERR
RQPGRGGAIPPSFLSTIQSTSVATGQLARFDAKIAGTKPLDVYWLKNGKKVMADIRYKTL
EEDNIYTLLILETVPEDTGKYECVAINSAGEARCEADCTVRGPQSPAKISKPTTPTEERA
PTVVVPLKDQTIKEGSSVAFACRITGKPVPTVQWKKADKVIKPSKYFQMQKEGDLCNLRI
SEAFPEDEGVYKCIAKNPAGEVTTSANLRVLAPDTADVLPKLTPLKDQIVAEGQPAQFKT
QVSPVKPKPTIQWYREGALIPQSPDFQMIHEGNNAVLLIATTYEEDTGTFTCRATTSAGT
VETSAKLIVKKRKEAHYAIPAETTASTKVDTKLAKEDIVLRSLDENGLPLEIQLQPGDES
LPWRKGRVYHRPQTSQPLPWRKVKPKSRDSSLDKLRAFESQIKPWTEEEVVLKKTSQIPK
DITKEKLEEVELKPTKIEKKEIHGPSLETVKLKSVPKDTTKAILTEEDVTRKDTTTTELY
TEETDASLLKSLRHLKETISKQEKTKPWTEEQIVLKKIKPKTTKVSEIDTLERTDYTEQE
DSSLLTISKDEETQKIKKEKLIIDKTEHPKPWTEEKIALKNAQPERKEIFKQTLETVTLK
PSHIVKKEIVKPTLKEVDLKSILKEESEVILKEEVQIDVSTVKKERRASKDIDKTITDQT
DKIEKPKPWTEEKVALKKSKPIQREIEKEALETVELKPSRPTKLVVRKPSLEKVDLKPVT
KEKVDTSITEIVKHVDYTEHEDTSLLQVSSEEVLDTTKLKQSKPSKKPTQDVGQYVEEED
ITLLKSERETTLNKQVRKRKEIPEEKSQLKPWTEEKVTLKKTKPEQKEIHKETLEEILLK
PVTKVDKVSQKQLIETTDLEHVRTEITDLTKVKKSEENLSYQEEEDQTILEMDKHVEYSE
KIKPKKKDIGKVPYKEEEDIAILAVDQTTDTQSTKKEIPIPWVRGKKGKKDVEEIQPSRI
PTPQDKPEEDQPTEIAEASWRRKPKPSKIQKEIEETVLKEHEVEEKAELPWKRKKQTPVI
KPAEKPEEKPEEVRLKPVKRIEKPEEPKPEEVILKPVKRLPKEEETKEEITLKPVERKKP
EEKPEEVRLKPVRRIEKPEEPKPEEVILKPVKRLPKEEETKEEITLKPVERKKPEEKPEE
VRLKPVKRLEKPEEPKPEEVILKPVRKVSKEEETKGEIVLKPVEPVEDKPKETAVPWRRG
KRTKKVVDFKEEVTIVPIDQEESVAEISEEKEISVITTETIQDQTEKEVDIVPVSKEGEK
VTEMVETSMVSWRKKKQDQTRRGEKETVKIKLMEQVKESSVKQPEEYIPVSNKDEILTEI
VEKEKITLKPISKKKIKEEDVVEEVTLKTVREEKITEEKLKEKIIEGPQIKKQAEVSEER
EETLIELIKRKPKKIEKVPKEIVPIVEEEKQEVITKTEKIEDIVEDVEVQVKKDITQIED
RKRKRRQRTQVDISIMDKDKTIAPRFIQKLQPVIAELEKPAKFTCTVIGNPTPEISWYKN
EQELHASEKYIMTIFETTATLEITKVKEEDAAMYSCRASNPAGVATSTVNLVIYEKEEEG
VAPHFATPIKPIMVEEHTPALLECVVTGTPVPEVKWYKGEKEVKPNERTEITFNPTTGEA
TLKIIEPISEDETIYRVRAVNKYGRAECRANLVISNIVKVSKPAVLRAPRITRPLPALIA
ERGKPLKLLADFEGIPKPEVKWFRNGIEIIPTNKNEIKIYENTTELIVSDVTKKDSGKYE
IRVQNEVGEARSSSSITVKERKDTSEVKAPRFVEPIQPQLVAEGEVVIMETKVESYPAAS
FQWFHESKLLESTPQVRIVTQENRSILMVKEVTPELAGSYTCRAENVGGSVTCTAVVNII
DTTWEEAVELVSPTFVKRLSPVRVMDGESVNLTCVVEGKPTPRVEWYHNDKPIKEGKEIT
IVQDMEGVCSLAITEVFPEDAGEYTCRAINPVGEAVCMSSLVVEAYEYVPDSEIASSIVA
TSLTTGSEEDLLSPKEIDTDVEESAPEIVKKLPQLVPIKDGELTRLEVKVKGKPKPKVKW
YKQGTEIVPSQEFLIEEFEDGTSVLTIAETFPDDTGEIVFEAHNPLGVSTTMTYLSVEGI
LGTKEYRKPEWVTHMEEMQEALRATQAVPRIVQETTDVYTREGDTAVFECVYSGNPKPDI
IWYKNDKIIMNTENVKVRIFENENRTTLTIKRPTKEDEATYICKATSEIGMITTKAKLRV
ESVSDFGLAPEEKVIEEEKVEIKLKKEEKPHKKKKPELKKAKEVKEKIKAERITIEKDKI
HEEKPVSKEQPEEKKIVRIEETQVLETTEIIEEKPEEISRARKIVPIQEPLITEATASLK
KIDDQKTQEIVPQVEERAKQIVEERESVVVSEIRSEDVAPDFTIETKLDRAQVISEPLQE
VSISETHVETRTQETKRTETKKKAKKVKAEKIKEDIIVMEIVERQKENIAREVDEIMELL
DVKEFGPGESPLRELATVGYLVRQGVSVNEINECLYRTEIFPALKTPDAQNALVQLVERK
GYGALITQVLTEETTTDESFVAATVGFRAFMRMVELQHATVEEVITHFAPEDFRPRAWEV
TEISEVETEQHATERVDYVRKTEVHFMERRDERKTTQDIQEIKGSEQRVSMHGIYSHDLL
S
NT seq 34206 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatacccgacgagagttcgcttcatatccgctcacattccgcacaaaatgtc
gaagcgaccaataaggatagcaataaggaagttgccgacaaatcttatagcgaaagcgct
acggaggaatataacgtagaatgttatacgacagctactgagtgctcgacaccacttcct
atctccagaagcgagtctttcgtgacgtcgccggaatgtgaagatctttttactacggcg
cctgtggtgacgccctcgtgttctagttccacttggatcactggaacgcctaaactaaca
actacaaccgcacctcattactctggtacgagcaatgagactcaaacaatgaaacctact
gaagtaatgtcaaatatttcctcctccattagcggcacacaaccaacaacacgtatcaaa
acgatggacaaaattactgacgaaagatcaggcaaaattgcgaaagaagtgacggagacg
accgtcttacgtgtatcgcataacgttcgattagacgtcgcctcttacaaagtcacgtca
aatacggtactagatcatcgacaacacattgatggaaaggttattcaagatatagaaagt
gtgataccagcggaatcacatgaaaaaacggatggtgttcatcaggattctgatgtctct
ttgttcaaagagtctgaaaaatgtgttgcgaagtgtccgaagaatgttcaatcggatcaa
aatgttacaacaaaattcacaaataaggttaacgagagctcgcgttctaatttaaaagaa
tacgaggatatttcgttgttttcgcaagagttatcgcgacatcacgaagacagcggaatt
gacatgtcgccgataaagaaggacgacaatttggaagacgacgagttcctcgagaaagcg
aggaagagcggcgaatggctgaagctgaaaatactcgagttgcaaccagaactaacgaaa
ctcggcgcttctgtaaaagaagctacggaattctcgaacgctcacgagcaagtgttactt
cggttacagaacaagcagaacccggtggaagaattactgcggcaagctgatcatctgatt
gcgacccagcaaaccaaagcggaagtgtacgcggcaatggcggaatcgttgggccaagcg
tggcgcgatgtgaatcaacttttggaacgtcgcaaggaaatactcgatcaaaacgtgttg
tttcaacgtcgtgcggcagaatgcagagaaaatatggatgcgttagagatggcgtgtaac
gacacgttgctgccgatcgagatcgaagcggtgagaaattttctatcaaagatccaggat
cttcgcaaggacatgctggaagcgctgatgggcgcgctgcgggaaggcaagacactgctg
gatcgactgaaggaattggcgaacgaaggcaccatagactcgagaccggatagagtcaag
gacgatgctaatcacgctatgctgctcgttgaaagatggctggaagaacttcacgacaga
aggcggctgatcgagacgtcttttcgcagcaggaagacacagttggagcaatgtctcgct
ctcgcgctgctcgcaaccgatcttcgtgatcttgaagaacttcttaacgacagaatagcc
gcgttagcaggtacttgcgatcagttaggggattctgcatctaatgcggagatgcttctc
tttgaattaaagaagttgcaagctgaagcaaaggacttccaagacagagcaattaaaata
accaaatcgaccgaacgattagtgtcatcaggacacttcgctggcgaacaagcgaccgaa
caggcatacgcgattcttagcgttgccgccgattacgtcaacgacttagatcagtatagc
acgctgttaaacaaagcaatggctttcttcgaatctgcacgatccgctctcacgaaattg
gatcaactggagattcaattgatgacaacggagcatcctccttattccgcgcgtctcgcg
cgcttccacgcgcaaactgttgccacgatagaagatgtgactgctaagcccctggcagaa
ggatatgcgctgctggatgtcacgggaagaggagcgcccggcgccgagggtgtaaggaac
accattaaagaacttgagaatcgcaagactagtttgatagaacggtgcacggctcataaa
gaagaaaatctggagatttcgagaatgcttgctacatttttggacaagcacgaagcgttg
cgagcttggctgactagcgtcgtcgaggcgtttcttcaagggcatcaagacatgggcagc
gatcttgcgatggcacgcgacttccgtcgagttcattgccaactgttgatcgatctagag
aataagagcgaggaagtggatcacctggaactggagatcttgccagtcgtagaacgcctg
gaggagacgcaaaaatacgaactgcgatcgaaaataaaaaatcttaaagatgaatggaca
aaaattaagatcgcacttgttaaaaggatcgaactgggcacgacttacatacagtttcac
gaaattgtcgaagaattgaccaacgaaatggattttatcaccgatgaactaaagaagtgt
gagggcgtgttaaatgaagctaagattaatgagttggaaaaaaaatggacgtctctggaa
ccactctacaagaaacttgacgatcatgcaaaagcgttcctcgatgaaacggacaatgtt
gatgacccttatctcgatgtatctcgagcttgtctgtgtgttcagacccttttagaaaag
ttcgccaatcggcaattggtcgtgaccgagtcgtgggaaaaatggcagaccaccatcgaa
attacaagacagagacgaatcgagtgcaaacgaaaaatcgaggaaagcgcaaagacatta
gcgtggatttcacaactggaaacaacgctatatcccgtgataacaacaccattctccaga
ataatcgatatcctggagaatttgaaggatgtaaagcaacggatcctacctgaactaaac
aaagctcttcaagaattggacactagaaagaaaaacattaaagtatttgtcgaaagagat
aacgctgaagcagccgagcaggtatcaaataaacttgtgcaaacatacgagaagacgtat
actgtcaccaaagattacgagattctattggagtctttaatttctatcttcaaaaatctt
gaagaggtcgagaataagatttgtcaaacaaagcgagaaagtgaatgcgtgtcgaatttc
acaagatcgattgatgtcgacggtgcattgagcgaactcgatatattgaaaacatttatc
acgaaattcttacaacaaatacgtacaaaatctgaagatatcatcgacagcattagacga
caggagccaccagaatcagcgacacaagatatcgagaaattgaaacgcgcgatacattcc
gtggtcgtcgagtacgagaggtttcagacggaaacaacgagctgtctcgagaaacaccga
cgactttgcatcttccgggaggatcttgagaaaattaattcggatctacgtgagttaaac
gatcagttgaagaatgtagacgaaaaacttggaaacaatttgtcagcatcgaaaactgcg
ttggccagtttcgaacagtttgagcaaactttaacgactttggaagaaaaaatagagatc
ttcgtaaaagaagctgaagagacgatcgttccatcaccgcctcaagtgacggacgagatt
ttgtcattgcgaaacagatttgatcatctgagacaatacgttcgagatatcaagaagcga
atgaatttaagtatcgaatactttgtgctcttggaagaagccaaacaatggtttagagaa
ggcagcaaacttctggtgattgttgcgcgtaaagcaacaagtgtcaaagtgcctgaagaa
accgtcgatttattgcgagagatcgaagcttacttgaagccaggcgaagagcaacaagaa
aaaagaattgagaagctcaagcaattgtcgactatagttttcggcacagacagactcccg
cagtttcaggaagtagtgggagaaaatcgtcagatgctggattcgtttgcagttatttct
tccgaattgcgtactcttagtcaaaatttacaaaccgccgaggatcttaaagagaaactg
caagccgagcagctggaagttgatcaaaagttacaggcggtcaagatagaaatggccgcg
gcagaagctgccagaaaggaggcggaaaatgcgaaaaaacttgcggaacaacttgcggct
gagacgttagacaaggctgcgatagaagcgagaagattaaaagaagaagaggcgcgaaaa
cttgtctctcccgtttcgcattctgtttctgcgcaaaccgaaactatagtggaagaaacg
gttacttccgccgtgacgacaaaagagattcatattcttcaaaagacggaagttgaaaaa
agtgttccagtcgttcagaaggaagttagtcccccaagaacactagtattcgaagaaatc
caagaaaaatcacgcaccgaagatttaaaagcggacaaactcgtttcgttggctccggag
tttacagttctcttgaacgacgcaacagtcgaggagggcaaagaattcaatttcgaatgt
cacttgatcggccagccgacgcccgaaatagtttggtacaaagacggaatatcgatttta
aacaatccggattatctgacgacttatctgaacggcgtttgcgtcttaaaaatagaagag
acgttcgctgaagattccgccaagtacacttgtcgagcattcaacattcttggctctgcc
gaaacttccgccattctgactgtcaaagaaaccgctgccgaagaacagccaagcggtcct
gtcttcgtaaaggaactgcaaccttcgaccgtaagggaaggatccgcgcatacattggag
tgcaccgttgaaggaaatcctcttcctacggtgcaatggtataagaacgacgtcaatatc
gataattcgccggattacgtgattactttcaataacggcgaagctattttgaagtttgat
gaggtctttctcgaagacaaagggttgtacacctgcaaagccacaaaccgatggggacaa
tcatctactactgcttctctcgatgtggaacccgcacaaatttctatgaagaaaccatat
ttcgtggtgccattgtctaacgctatggccagggcggggcaaagagtgaaactagagtgc
gaagccggcggagatccaattcccgaattaagctggagtcacgacggaaaacaactcgaa
gaaaccagatatcataaaattcaaacggatggcgctcgaacgagtttgactatcacggag
gcttttccaaaggatgccggatcctactcggtaactgccaaaaatgaggtcggcgaggcc
actgcatcctgcacagtttccgttaaaggacgtttggttcacgaaaccagtgaatccgac
tttgtttgcagcgacacggaaccgatagttccaaagtttcaggtgcctctacgcgatctc
aagatccaagaaggacgttcggccagactggactgcgtgattgttggccaaccagaacca
gaagtgatctggtaccacgatgatcaacctgtgaaagaatcgtccgattttcaactactc
tttcaaggtgacagatgttcgctggttattcacgaagctttcttggatgacgccggcatg
tacaaagtagtcgccattaattctggcggcgaagcttctagtcaatgtacattaacagtt
acaccggcgtctcacatctcggatgtacaaaaagaagaagaaactctcgtcagtggttcc
ccgccaaagtttgttcggcttccaacggacttgttggtggctgagggtgaagatgcgttt
ttcgaatgtgctgtaactggacaacccaaacctgatctgagatggtactcggatgattgt
gaagttacacgtaaggagaggattctaattgaagaaaaggaagatggaacaagaatattg
aaaattttgtcaaccacaccggaagataagggcaattatgtggcgaaagccataaatgcg
catggcgaggcgaaagctttcgccagattggtcgtgagatccttgggtgattttaagaga
aacgaagagttagttcaaatggaagaaaaattgattcagccaacgttcaaagaagtattt
aaagacagaacggttcctgaaggagcttcaacaaaattcgaatgcattgtcactggaaaa
ccttctcccaagattcagtggttgtttaatgatcagccggttcatggaaaagattttcta
gtttctgttagtggagatcgacaggttctggcaattcctgaagtcgggaatgcgcatatc
ggtacaatttcttgtgtagcggaaaacgcggctggtcgagcaatttgcagtgctaaagtg
gaaatcagtagtggattcgagcagcaaactatagacgaaattgaaagagttcttgagata
gttccgcaatcacctgcagagatcatgcatcctgcaagcagcagcgagaaacacttctca
agcgagaagacgtatcacgaaggcggtagcgaaagtcaagtgctgactaagatgtcgtcg
tccgttacacattcttcgacaacgtctatgaagaaagaattcatatcatccactatgaca
tcatcgcaatccggacaagaacccagcagcgtttgcacaaaaacaactgtgcaaagttcg
gagcaatctacttcggaaaacggagcaccacctgtcgtacaatctcacaagatccaggag
ttcgagaagatcatacaggaacaaccaaaagagatgcggcaagaaaaaactgtcatcgtg
tctgaagagacggacagcgcgaagcgagatgttaagacaagtcaagttcaaaaaccgtcc
agaaaatcgacagcacctagattcgtctcaccaattacagggatgatcgtcgatcaagga
tcagatgtagttctcgagggtatcatcgatggttttccgcagccgaccgtcacatggtcg
aagaacggtcaagagttgacgtccaaagataatataaaaattagttatgctcacaatcac
gtgaaattggagctgaagaatgccagtgtaaaggatgctggacgttatacttgcatggta
aacaatgatgttggaagtgccagtagtactgctgatcttgttgttaaaaagacaatattt
cctcccgtttttggcaaacgtctcaaagctcaagtggttaaaaaaggagatcgtgttatt
atggaagtggaaattaccggtatcccggatccgaccgttagttggtacaaaaacgacgtg
ccgatcagtgaacgaccaccagaattgaggattattcatcaaggaaattgttacacactg
atcatagataaagccaaggaagaagatgctggaaaatacatggtgcgagcgacaaatgct
ggtggagaggcgcaaagtatagctgacgttgcggttttcgatccaaagcccgaaacaatg
atcgaggaacacaggactgtcatctacgatgatgtccaaggcaaaagtgtcgtccagtcc
gagggaaaaaaagaagagatatctacatcaggcattttgatgagcgaaacaccaatcgca
acgtttctgccgagcgcatttaagccagtaacgacactgatgtcgaccacgtttgacaca
gtgaaaaaaatcgagcaaccggagattacggctactaagtcggaaaagatttcgtcgata
atcgaatcccacgaaagcgagacgaagtcagaacagaagtttcatatgaaattggaacac
aaaactccgtccatcgtggaaatgaaatctccgatcgaacaaacaatcgcggtaaaggaa
ctcgaccgtgacaagaaagacatcatggagtcgtttacgaagataaaagaagaaacgatc
gagaacgaaaatatagagacttcgagaattgccaaaaaagacgcgctgagcttctttgag
tctatgacaaaggagaccgagataataccgaagaaaccaaaagaaatgattaagttgaca
gaggacggacaagctcaagaagctaaagtgggcaaactggcgcaaagttatgagcgagtg
tcgactcaagaagtgaagaaaccagaatcgagaccgctggagtttcaaacaacaaaaaaa
actatgcaagatatctttactaagttcgagcaaggatcgtcgcctcgcggagtggagaat
aaactgttcgagtttccgtatgaaagtcctaaagtggaaacaaaaaaaactattgtggag
gagatgataacttccggttcgtccatttcggaactgcaaattcagacagagagttctgaa
acgttaatgaaaagtttcaatctggtgccggaaccacctcccgaaatatgttacatgccg
aaaccggaagagttgagaaaaaagcgacccgacatatctgttaaggcaaagcagcttcaa
gaatcttttgaaaaaacaatatcacccatcgacgccccgatcggcggtgtaaagatcttt
cccacgtctctctcgaagacgccggagtctgctcccgtgcgtcctgtcaaaatcacggaa
ccgactcttgtgtgtacaataccaccgccgttcgaactcgaaaagaaagaaatgttagaa
gagatatgtgtgaaaaaagatgcgcacgaaaaaaaggaaagtaaatattttaaagaagaa
aaaacggagccatttcgatatacgtcgatgtcaacgtctatcgtaagaagtgcttctccc
accagaccgtggtcgtcgtcatcggacgtagaaaccaaatcacatgtgtccacggatctg
tcagaatatagatgtcattcggccgcttctagtcaccaggagattctgcgatcgtcgtca
cctagaccgtctgccgatgggctggcaatggaaaaatcctgggcaaaaaagtgcgcggac
tcgaacagaaaatcgtggccgcctccaagcgattccgcccagaaatggaatgttcccgtc
gacgagtacaagagctccacgaaagagttcaagcagaaggtcgaagaaacgccgcaaggt
gtaaaaaagatcagcacggagtcgtccgccagtgtggaaaaacgttcgtggtccagcaaa
gaagagttcacggagaagatagtggaaaagacaccgccggcgagactcggtccgataatc
tacaacgccgaaacgatcaaagtcgatcacaccgtgaacacgatgcaggaaaagtcactt
tacgagaagtacatgagcgagtgcaacgtagagaaagcagagacaatgcagaagtttgaa
gaatttggttcaaaacaatggacggatgggaaagagctgaaagcacctagtttggtgaag
aaagtcgaaccactcgcgaaaccacttgtgacgccttctcttgtacagaccgaaatagac
tcgatcatcctcaagccaggatcgcctccagaaattggatacgttccaccacccataaag
gagacaactatgatcgaacaaaaagaaatagactcgatcgttctcaagccaggatcgcct
ccagaaattggatacgttccgccacccataaaagagaaaactgtgattgaacgcacggaa
atggattcgatcgttatcaagccggaatcatctccgaaaattgcatatattccacctcct
ataaaagagaaaactgtgatcgaacatgttgcaaaagtagaaaagaagatagaatcaccc
gtgcgtattacaccaccacctgtacttccgccaaaagacatgcgcatcacacctccgcct
gtcccagccaagaaacccgcgaaagtctcgacgccaatgccatcgaagttcgtcaaaagt
tcattcggtcatgagagtgactacgaatccgattttgagggtcgtctaaaagcgaagtgg
agaccctatgaaagcgacaatgaagagccgcactatcggagagtcaaggcacctgttctg
aaacaaccaacgagaccgagatccaccgagcccgagccactgccgccgtcccaattcgag
actcctacgccattcacaggactgtccaaatctttagttaccacggaatctaccgaaaag
ataataaaaaagacggcagtcaaacgacacgagaaagaatttaaacaacagcagcaacaa
gagcaaacttcaattcctctgaaaccaggttcaccgccgatttatgtgcagccggccacg
aagagttccgcgccaagatctccttccgccaagaaaccggaatctccgaagtttaaaaca
aaagttttccaacaggaaagtggttacatggcagataccgatgagccctttcagcagaaa
atttcatccacaacgatgcaaaaatcttatggaaaacgcgacggttcttcgacatttcac
acggagagccgtaccacgtgcactgaaagcaagacaaaaatcttcgaaactcgcagttac
gaaagcgatcagtttcgtaaagaagaatctttcgtctcgccatctatttctagcgtgcaa
accagtcccaaagtcgctcaacagcaacgcagctcgttcgagaaaagttacgcctcgtca
actagcagcggtctgcacaaattcgattccgtgaaggaaacggaaaagattctgccaacc
tctccgagtccttcgagatttgtgaagggcgacttccgcgagagtgactacgaaagcgac
tacgacggcaaaacatcgtcatgtcgcacagttagctcctcaaaacttactagtattact
gattcaggaaagcaaacggagtcgactttgcatcgcaagcaatttacgccgacaaagccg
aaaacagttcttttacccggttctccgccggagctcgcgtacgcgccgcctcaaccgcag
caacaacagcagcagcagcagcagcaattttacgaggcacgcacgagtatgccgttcacg
aacgcggtgggtaccgagaccaagaagaccgtaaggatggacgaatcgacgaaaaacgcc
agaagaattgttactgtcgagcaaacgagtcgagttatcaagtttggcgacacaaatgcc
acgtctcaaaaacaacactatcgcgtgccagtcccgaagaaatttgtgcagggacagttt
cgggaatctgattacgaaagcgacgtggactcgaaaatccgaccgaaatgggcaccgcct
gatagcgacacagaggaacctcattatcgaagagtccaaccgcccgcggcaaaaagtctg
agatcgtcgagtgcaccggttaggcagacgcacgttgcatcgccgatggagttcgacacc
ggtccttcggtgacgcaggttcgccaagaagatacagacaaaaagattgatcaaagatat
cagcaacaaactacttccgaaaagattgatttgcagcctggttcgccgcccgaatatggg
ttcgtttccagaagcgacgtgaaaaaagcagcagaccacatcgcgacacgtcatatgagc
gacatgacgagcagcttcaagtcgaaaaccgaaaaattcgtgaccgatatccagtcggat
ttgagacagagcaaaccgattctgaagcatcccgtcgaatcgaggacaaccgataccgac
gagccgagaacgtatagagaggaatcgcgggtctccgaacatggaacgaaacaaatcgat
ccggacacaggactcatatatttcaagtacgactttggctacgaattcggtatcgttttg
ccgggcgaggggaagaaaacagtggagagcagcaagaagaccatccagggacagagacgc
gcaagtgatgtcgaagtgccgatagtccacgagtttactgagaagaagacgaacggtttt
gcgaaaagaaacacgtttccgagccgccagagcaaaccgggaagtaaattcggatgctcg
aaaaccgtcaagtgggagccgacgtccgagagcgaattttctgaggccgaagacacgaga
agtctcagtaaaaaaccatcgagcctcgataactcgatggcgccaccgagtctcatcata
cctagctctgtatcgccgtctcgatgggatcgcgtaacactcagcccgctttctctcagt
ccaagtctgcccagtctctctcccagacatagtagcgccactggaccacctagcaatgtg
gattccgcaggttcaccttggccaactagcaacggcgtgtcatcgggcaaagaagtgatt
cagccttatctggacatattaccaaaaaaagctcctacgtttatcacgccattgaaagat
atcgcggtagtaagtggacaaccggctagatttgaatgcatcgttcaagctgaaccgcag
cctaatattctttggtcgaaagatcgcagaatcgttgaaaattctacaaatcacgatgtc
caatacagaaacggcgtttgtcgtcttactataatgagagcttctcccgaggatgctggg
acttatgcatgtacggcaacgaacagcctaggttccactgtgacttctgccaacttggag
gttccaggcgcatcgtcgatatccgacacttaccgcgatcataagaaatgcaccgttgag
cagtttccgcaggattcgcagagatacgtagctttaagagatctattcttttcacaagac
aaaccacgcattctaacaaatcacgaacgactgtacaagtccctttatgatttcggattg
tcagacagtttcgtagatgcaaacaatcacgaaaatgaaggaaatagatttgataattac
attaaacgtgaatggagtgctatttacgcaagaaatggaatcggtgattcacgtttgaat
gtcaaacgttcattgcacaatctcactggaacgtgtaacatagaacatgttcaaggagag
atcgtaatgcaatcgacgcctacagtaccaacatttaccggtagacccggcgatccttca
ccgccaattttcgagcgaatcttcaagaacgcgagattcgcgcagggcggcaatgcgatt
tttgaaggctgcgtacgaggtaatccaaaacctacagtttcttggacacacaaagggacg
ccgttgctggaatcacgaaagattcgaatgtcctacgacgagaatactggaattgtcaca
cttcaaattaatcaaattggtccgggagacgagggcgaatacacgtgcagcgcgaagaat
caatatggcgaagcgatttgctcggtttacatacagccggagggattcggtccgccagcg
caacagcccacggatagctacagaaaggaattcacgcagagctaccagacaagcgaacaa
aaaatgcaaaccggtagccaaatgttccaacaacgcagttatcagcaatcgatagataaa
cgaagttatgtcaacggcactactacaagcatcgaggatttcaaggtcgacaccttcgaa
tacagattgttgcgcgaaacggaataccgggaatcgattactcgtcgcttcgccggcgaa
tctgactcgcagatctccactatgatcgatcgtactctgggaccagttgcacccccgcaa
atcactcagaagcccagaaattcgaaacttgttgaaggatcggacgctgtcttcaccgca
aaaataacaggcaatccgaaaccaagattaacatggttcaaaaatggtcagaggatccga
gactcccaacgcgtagagacaagctattcgaatcaacaggctactctacgaatccgagtc
gctttgccggaagatagcggtcattacacattgttgtccgagaatccccaaggttgcact
gttagctccgcttatttagcaattgaatctagcgatcaagtagatcaagttccgtatcaa
gctcaaagagaatttattaagacacaacaggtagaatcgaccagcgagtccgctgactct
ggcaaagttctaccgccgaattttgttcgcactatcacagatagagaagctaccgaaggc
aaaatgacgcgattcgattgtcgtgtaaccggtcgtccgtatcccgaagtcacttggtat
attaatggccagcaagtcgccaatgacctgactcacaaaatactcgtgaatgaatccggc
aacaattcattgatgatcacaaatgtgagtcgcttcgacgccggcgttgtaacttgcatc
gcccgaaacaaagctggcgaaacttcctgtcagtgcaacttaaacgtcatcgagaaggaa
caagtgatcgcgccgaaattcgtggaacgttttgtcacgacgagcgtaaaggaaggagaa
cccgtgacttttatggcccgcgcagtcggcacgccaatcccgcgtatcacttggcaaaag
gacggtgtaccgataacgcccgggtccgaaatacgtatatcgagtgacggtagcggagcc
tcgagcttggatatctcgtgcgccaaattttcagacgcagcctggtatcaatgcaccgct
caaaacgtagctggctctaccgcgacccgagcacggctctttgttgagacgccaaaagga
acggccccggaaccaagacgcctgaatttaccccgaccgacgaaaatcatcgaaccagaa
ccagcgcctggccccgaagtgatttatttgagacatgtggaacgagccaaaccttacttg
ccgcctccagaagaagacacgatttatccaccgccacgtttcattataccattgaaggat
ctttatcagatcgaaggtggacgaattcacttcgaggccagaatcgaaccggtgggcgac
cccactatgagggtggagtggtacgtcaacggcagagcactcgacgcaagttcccgagcg
acttctatcttccgcttcgggtttatttctctcgatctcattagtattgttcttcaagat
agcggcgagtatttttgccgcgtcgtgagctcgaccggagttgctgaatctcgcgccacc
ctcagcgtgacaccacgcgctacgattgaacagacaagccaacatcccgacagtctccag
tatattcaacagcttgaggattacagcaaataccaaaggcaggagagcgtggaggagacc
tcttcacagcggccggttttcatccgcccgctccaggatcttggtgagctacaggaaggt
cgaaacgcccattttgaggcgcagttgacgcctgttagcgaccccaccatgaaagtggag
tggtacaaggatggaaaaccgatcacagccagctcaagaatcactaacatcttcaacttc
ggatacgtctcgcttaatataatgcacctacgagctgaagatgcaggttcttatacagtt
agagctgtgaaccgcttgggagaggccatcagctccgcgactcttcgtgtctttgcgcga
acaagcgtaacgacggatttgggtatccccgagcaaatgagatacatcgaggctgccgag
gagttggaagcatatcagcaggcaatgcaccaaaaatacgttcaggagcagcctgaaccg
agcagcccaccggaatttaaatcgcctatcaaggatcaaagcagcatacgagaaggcgga
ttcgctcattttgaggcgcgtcttgagccagttggcgattctaatcttcgtgttgaatgg
ctcaaagatggacgacctgtagaagctagttcacggattacaacatttttcaacttcggt
tacgtggcactgactatcaaatacgtaacgatacacgatgtcggtgtatatacttgtcga
gcgtataacagagttggtgaagctcacaccaatgctcaattaagcgtaatcagcaaagac
gatgttatttatgacagccagcatcccactggtcttcaaaaaattcaaactcttgaagat
tcgagcagatattcgcgacaggttcaggaagagacgcaggtcacacaagcaccgcgattt
ctcggtaatctgaagggcactaacaagatcgtggaaggtcagcgagcgcactttgaagca
cgtgtggaacctcagagcgatctaagcatgacgatagagtggtaccacaatggcaagccg
attaccgctgccaacagaatccaaacgtatcatgattttggatatgttgcaattgatata
ctccaggtccgttcggaagatgctggcacatacaccgttgtagctcgaaattctcgcgga
gaggctcgtctatccgccactatgattgttgaaacacgttccagtatagatacgagcagt
atgcatcgtggcacttacgagaagactcaacgtttagaggaatccaagtttgtcgagccg
caataccacatcgaagagatttccaagtcaaaaccgatctttattcaaccactgagcgac
cccaaaccagtcagcgagggtaaaaatattcacttggagtgtcgtctggaacccatgggt
gatcctactatgcgagtggaatggttccaaaacggacgtccggtcacagttggttccaga
ttcagaacttattacgattttggattcgttgcgcttgacatcgtacacgcaactgcctac
gattctggcgaatacacggtcagagctactaatcatttgggtaccgcgcatacttctgcc
tgcgttagagtcatcggcagatctgacattgtcactgacacgcagaatgagcaatcactc
gagcaaatacagatgctagaggactcatcgagatatcgtagaactcaacaagaggaagtt
actgtgatgcaagcacctcagttcactcgacctttacacaacatcgagacagtggaactg
accaatgttcacttggaatgtcgtcttcagccagtcggtgacgcgaccatgaaagttgac
tggtttgtcaacggccgaccggtcaaaactggtcatcgattcagaccgtcttacgaattt
gattacgtggctctggacattctcggtgtctatcctgaagactccggcgtgtacacctgt
caagccagaaatcagctcggagaagcagttacttcgtgctctgttagagtacacgcgaag
aaagatctacttctagaatcccaacatcctgagggtctagaaaggatacaatatttagaa
gatgcctcgcgatacaagagacacgaactcgttgatgaagtcgtcaatgtaaagccaaga
tttattacgaaaccgaaaaaccaagaaaatctccgagagggacaacatgctcattttgaa
tgcaaacttgaaccagtgacggattcaaatttaaaagtcgagtggtttaaaaatggccgt
ccagtaacaatagggcatcgttttcgtccaattcacgactttggctatgtagcattagat
gtaattgatttgattgccgaggactctggaacatatacctgtcgcgccgttaatctggta
ggcagcgacgaggtaacttgcattttgacatgtcgttcaagtgcacaaattttgacggac
acgcaaaacgagcttggactcgaacagattcattatctcgaagacagatctaaatatcaa
agaaaagaatttgtcgaagaaacaactactcaagcacctatttttacaacttcgttgaac
aatgtcgagatcaaagagggtcagcgggctcatttcgaatgcagattgattccagtgtct
gacgcgacaatgaagatcgaatggtttcacaataacaagccggtgaaagcgggctcgaga
ttcgttgagacgaatagttttggtttcgtcgctcttgatattatgtacgcgtatcccgaa
gattccggaacctacacttgcagagctagaaatatcattggtgaagctattacatccgca
actgcaatcgttcactccaaaaagtcaatctacacagaaactcaaaacgaggaaactttg
caacgtcttcgatctttggaggatacatcccgttatcaacgcaaaactacaactgaggag
atcatcacgcaagcgcctgtctttacaatgccgatcaaagatctccgtgttgctgaaaat
caggcagcacatttcgaagcgcgaattataccggttggagatcccaaactcaaagtagaa
tggttacgtaacggagtttccatttcagcctcaaatcgtgtgactactatgcacgacttt
ggatacgtcgccttaaacatgaagtacgtcaatcccgaagattcaggcacttacacatgt
cgcgctacaaacgagctcggcgaagctgttacttcagcaacattattcgttcaatccaaa
gcagccttgcagtttgagtcgcaacacgagagcgctttgtcgaaactccaagctctggag
gacacctcgaaatatcagcgtcgtgaagaagaagagattgtggtaaaagacaaaccgtcc
tttactgtccaattgaatggacctaccagtttagtcgaaggtcaaagcgcacattatgag
tgccgtatagaaccttatcccgaccccaatatgaaggtggaatggttccacaatggcaaa
ccattatccaccggtcacaggtacagaactacctgcgactttggattcgcatcgttggat
gtgttgaccgtctacgccgaggattcgggcacgtacacttgtcgagccaccaataaattg
gggtcggcacaaagctcgattaatctttctgttaaatctcgagcatcgattatacacgac
actcaacatgagagcgcgttgaagaaaatacaatatctcgaggacgactcaagatacaaa
cgtgtggtcgaagaagatacgatcatcgccgaaaagcccactttcggacgaccactgaaa
aatatcgaacacctaccggaaggcaaaagcgctcatcttgaagctacgttgactcctgtg
aatgatccgacaatggttgtggaatggttccgaaacggacgacccattccccagggacat
aagttcaagacaacttacgactttggatatgtcgctcttgacattctttatgcttatcct
gaagattcgggtacttacatgtgcaaagcaaaaaatgccgttggcgaagctgttactaca
tgtgtcatcactgtggattcaaaacaaggcttgtacctcgatactttggatgcccaacgt
ctgcaaaagattcgagaattggaaactgtcgaaatcaaagaggaagttgaaaaagaagtt
attcatcagaaacctgtgttcttgacaccattgaacaatctggatcatcttaaggaaggc
gaacacgctcatttggaatgtcgcgtggagccgattaatgatcctaatttgaaaatcgag
tggtttgtcaatggagtcgcgatcaaaactggtcatcgcttccgtacaacacacgatttt
ggctatgtagctcttgatattctttatacttatcccgaagattccggtacttatatgtgt
aaagcaaccaacctagctggagaagctgtcaacacttgtactatcaaagttagctcgcga
cgaagtattcttctggacactcaacatccagatggtctagagaagattcgagaactcgaa
gcccacggtcatcctgcgcgattagaagtcgaagaaccgccggtgacaccaccaagattt
atcactgaacttagaggaactactgaagtatatgaaggacaaactgctcacttcgagtgc
caagtagaaccactgcacgacgccaacttgagaattgaatttttccacaatgaaaaacct
ttgccatcagcagcgcgtttccatgtaaccttcgattttggctatgtagcccttgacatc
ggtcatgctgtgcccgaagacgcgggacaatactccgtacgagcgattaacgctttggga
cagtgtgtatcgtccattgagctcaaagtaattccacgagataacatcattctggattct
caacgacccgaaggaatggacaagatccgggagctcgaatctcaacaaccgtggaaaaga
ccagagataccagaaccacagactagacagcggccagtctttactcagcctttgcaaaat
attgacagcattgctgaaggtcacaccgcgcatttcgaatgtaggctcatacctgtgggt
gatcctatgctaaaggtagaatggttcagaaacgaagtgcctcttgaaacaagttcacgt
attacgaaagtacacgactttggatacgtgtctttggatattgctcacgtgcgtgaagaa
gacgaaggcgtttatatgtgtcgtgcttctaatcccttgggtgaagcagtcactactgct
tcgatgaagatcaaaagtaaagcaagcatacaactagagactcagcatcccgaagcacaa
cgcagaatcgctcaactggaagccaaagaagttgaacgaccggaagaaccggagaaagtc
tttgacaaacctattttcacgcaattacttacaggaccaactgaactttgggaaggacag
atggctagatatgagtgcagagtcgttcctgttggcgacgctagcttaagattcgaatgg
tatttgaacggagttgaattaaaaatgggttcacgcttccatacgaatcatgactttgga
tacgtgacgttagatatcctcaaagttatctcagaagattccggagtttatacttgtaaa
gcgattaacaaagcaggtgaggcagtatcatcgatctctctgaaagtgaaagcacgctca
gccatcgattccgacagtatacaagcaaatgcttggcaaaaaattcaattgaaagaagcg
gaaatgaacaaagtgccggagatgtttatcgacacaacaccgcaacaggcgccagtgttc
acaaagcatcttgagagctatgacaaactggtagaaggtcaacacgtttacttagaagct
caggtggagccgagagccgatcccaacttgagagtagaatggttcaaaaatggtgtggct
ttgcaaaccggaacgagacttcgtagtactttcgattttggtttggtgacattatcgatc
aatagtctaagagctgatgattctgcgatttacacttgcaaagcaaccaatcttttggga
gaagccgtgtcaacctgtagcttgaagattaccgatcgtcactggctgttgggagatact
ctgcatcccgacgcactcccgaagatcgacgctttggagcaacctcaagtgacttctact
gaacaaccagaacctatttatgaggaaccagtgttcatcactcatttaaacaatgtggaa
tgcatcgaaggcgataacgctcacttcgagtgtaacgtggaaccatcaaaagatccaact
atgaagatagaatggttcctgaatagcaaacctttgccgactggtgcgagattcaagagt
acgtatgatttcggttacgtagctctagatttgactcatgcgtatgaagaagattccggc
ataattaccgttaaagccacaaactcaaaaggaagtgcgcaaacttcgggtactttgaag
tgcaccagcaagcaaaacatctatttgcaaacgcaacatccgcaaggagaagccggactt
gaaaaggtaaaggaagccgaagatgcatttctgtcaaagtatagaagaccagatgaagct
cccgaacacgaatatcctaaaccaatctggacggtgcctcttcaacctgaatttaaactg
ggagagtctgaaccgttacatttagaaggacaagtcgagcccaaggatgatcccaattta
aagatcgaatggtatttcaacggaaaaccattagaacacggttcacgtttcaaaatgacg
agtgattttggttttgttaccttggatttgaccgatgtttacgagcgtgattccggtatt
tacacctgcaaggcttacaacaaagcaggtgaagcctttacatcaacgacaatttattgt
tcgaccaaagaaaatatcatcgagaaatcgcaacatcctaaaggtaaagaaggtcttgaa
gctattcaagatctggaggagtcgctgaaacgacaggaaggagttgcaccaggtgaggaa
gaaggtcaaccaccgcaattcacttcgcaattcgaaaatctaactaatctatccgagggt
gagattgctcacttcgaagcatccctcatccctactggtgatcaaactatggtggttgaa
tggttctataacggcaaatcgttggaagctagccatcgcacgagaactgtttatgctttc
ggcatggttgttcttgaagtccttggcactaagatagaagattctggtacttacacttgc
agagctactaacaagtggggcaaagctgagattagcgtgcaattagagtgcatcgataaa
tctaaaggacaaaaacctaaattcacaacgcatattcagtctctggaaggtctgaaagac
ggccaatcggctcacttcgagtgcactctaattccagttggtgatccttgtatgaaagtc
gagtggttccataacggaaagcctctacgacattcctcacgtttcaaaatggtctctgat
tttggttttgtcgttatggacattgctggagtgatgtctcacgataccggagaatatgtt
tgcaaagctagtaacaagtacggtgaagattacacgaaagccacaatcaaatgctttggc
aaaagtggtgtttacttagattccctgcagccggactcacttgctagaatccgggagctc
gaaagttacagcggagagcaaccaactacgcccacaactcctgttgctgaaccaccaaaa
tttattacacagatctccgacattacaaaactagtggaaggacagtccgcgcatttcgag
gccagactgactcccgtgaacgatcccgatttgaaagtcgagtggtattataacggcaag
aaacttcctcacggccatcgatatcgtaccttccatgactttggcatcgttattctggac
attctctactgttacgaagagaattccggagtttacgagtgcagagccgttaataagtac
ggtgaagattctacaaaagcaactctcaaatgcttctccaaaaccaatcttgtattggag
tcgcaacttccaaaaggtatggaaggcggtttggaaaagatccaaactctcgaagattca
atgatacgcacaagagacgagaagactgtggaagaacgcggtaaagctccagtatttacc
gtgcccttaagtaatatcgatggtctacgtgaaggagaaagcgcacatttcgaagcacga
ttgatacctacagacgatccaaaattaaaggtcgaatggttctggaatggcaaaccatta
cgaacgggatctcgcttccgtactttttgcgattttggtttcgtcattttggaaatttct
cccatttatcctgaggattccggcgagtatagttgtagagcaacaaacgactacggtgag
gcagtaacaacgtgcacaatgaagtgtacaggtaaacgtagcatcattctggaatctcag
ttgccgaaaggtatggagagtacaatcgacaagatcgccgaattggaaggccttggaaat
gtacctggccaggctagtcctgaagacgacactggaagaccaccagagtttattaccacg
ccttctgacctgactctggcagaaaactctcttgctcactttgaatgtcgtctgcaacct
atcaacgattctagtatgagagtagagtggttccacaatggcaaacctcttcttgctggc
agcagaatcaaaacaattcacgactttggttttgtcatcctggaagtcgcaaattgttat
caacgcgattctggtttatatacttgcaaagctactaatcgccatggagaagctacagtg
tcgtgcaaacttcaagttcgaggacgtcaaggtatcatcttggagcctcaactaccaagc
aatttcaaaaccggtacggagagtatacagaaattggaggagtctctgtacaagagggat
gaaattctggcggaggaggaaaaaccgaatccaccgagatttacagtcgaacttaaagac
atcgaagtcgaggaaggtggatcgagccactttgattgtagagtcgagcctgtgggtgat
tctactatgcgcattgattggttccataatagcagaccttttgcgacaggctctcgagtc
catcagattaatgatttcggatttatatcattagacatgtcgtatacatatgcgcgagac
agtggcgaatatgtttgcagagctaccaataaatggggttctgccactaccaaagccact
atcacttgcaagtccaagaaaacaatagactttgactctcaattgccatcgggaatgagc
ggcgagaaattgaaagaattagaacgaggaccggtctctgaagctcccaaagaagaagcg
cctcgacaacctcctcgctttatcactcaaatcgagtcagcaactattgacgagggagaa
ccagtcagattcgaatgtcgtgtagaacccaaagaagatcccaatctgcgcattgaatgg
tacagaaacggtaaattaattcctgctggacacaggtacagatcggtctacgatatggga
ttcgtctcgatggacattctatacgtttatcctgaagattctggtgaatacgtttgcaaa
gccatcaacgatcttggagaagacactactcgagctgccgtatcttgcaaaaaattacca
agcatcattctgcagaatcaagttccgaaaggtatgaagaaatccgaagccctaatgcaa
atggaagcgacaatcaagaagtatacttcggaagttcacttgaccgaagatgatctgtat
gatgcggataagaaacagccacctcgttttgtcacacagattcaggatcaaactgatctt
gtcgaaatgaatagtacaaagtttgagtgtcaattagcgcctgttggtgatccaaacatg
aaagttgaatggtttttcaatggaaaaccattgcctcataaaaatcgattcacgccgatc
tacgactttggttacgtagcaatgaacttcggctgggtctatccggaagacagcggcgaa
tatctttgcagagctacgaacctttacggaatggacgagaccagagctattattagaacc
gctggtaaaccaggaattatctacgagtctcaacttccaaaaggcatgaagagtattgag
aaaataagggagatggaggcagcatggcaaattgtgcccgaagaggaaggtgaagaagaa
aaggtacgttcagcgcctgttttcgtaagtaaaccggaaccagtaactgtcgaagaaggc
gactggtccagattttgctgtcgagttactgggcatccaagacctcgagttatgtggata
atcaatggccatacagtagtaaatggatctcgctataagctaacgtacgatggcatgtat
catttggatatcccaaaaaccagacagtacgatcatggcaaggtagaagtaatcgcaaga
agctccgttggcgaagcacgcacagaaacgactctaacagttaaacaacgaagcgatgat
tatcgtggtgtattgaaaaattcaccgagaccctggtatgattatgggctaacgcagtat
cagactgagcggcagaatacagaactggagcgtgtgtttgatgaacgtcatcaaagcgtt
tcccaaggtgtcgaaattgctacggaacatcttgctcctaaagtcattaaagaacccgaa
accgaatggcagaaatcagtcaagagtaagaaaaatgaagtttattacaataaattgatg
agccttgaagaggaccaaatactcaaagaaaccagattgagagaatcttcacatcagttt
gccattcctggcgacaaagttgtcgcgaattctttagcaaaaggaatggcccaaaagtat
gaagagagtttagaagagcagcctcaacaaccgccacagacacctccaactacaaaatat
gtgaagaaaccgtttgttactgaagtagacatagacactgaacgtgtgaaagcgacagga
aaatatcctccggaaccatcggaatccactgtacatggtcgcgaagttcacgtagctaag
cagaaacagacgcaaaaagagataaagggtgatctagaaataacaaggaaaatcacagcg
acagagactacagaagtggagcacaaagcgaaaactcaggaacgtgtggttcagggtcaa
gttaaacccgccaaaccgcctgtttttacaaaaaaaattcaaccttgcagagcattcgag
caagaacaagccaaatttgaggttgagtttgatggcgatccactaccaaccatcaaatgg
tatcgcgaagattttcccatacaaaactcagccgatcttcaaatttacacttttagtacc
aaatcggtgttgattatcagacaagtcttcatggaagattccggtgtcttttctgttatt
gctgagaacagaggaggaaaagctaaatgcagcgctaatttggttgttgaagaacgcaga
agacaacctggacggggcggtgcaataccacctagtttcttatccacgattcaatctact
tctgtagccactggacagcttgctagatttgatgccaaaatcgctggtaccaaacctttg
gatgtttattggcttaagaatggcaagaaagtaatggcagatatccgttacaaaacgtta
gaagaagacaacatttatacgcttctgatcttagagacagtaccagaagacactggcaaa
tacgaatgtgtcgcgatcaatagtgctggagaagcaagatgcgaagcggattgcactgtt
cgtggacctcaatctccggcaaagatttcgaaacccacaacaccaacagaagagagagcg
ccgactgttgtggtaccattaaaggatcaaactatcaaagaaggaagttccgtcgctttt
gcctgcaggattacaggaaaacctgttcctacagtacagtggaaaaaagccgataaggtg
attaaaccgtcgaagtacttccaaatgcagaaagaaggcgatctttgcaatctaagaatc
tcagaagcattccccgaagacgagggtgtttacaaatgcattgccaaaaaccccgctggc
gaagttactacatctgctaatctcagagttctcgcgcccgacacagctgacgttttgccg
aaactgacacctttgaaagatcaaatagtcgcggagggacagccggctcaattcaaaacc
caagtgagtccggtgaagcctaagccaacaattcagtggtatcgagaaggtgctttgatt
ccacaatcgccagacttccagatgattcacgaaggcaacaatgcggtgctactcatagca
accacctacgaggaggataccggcacttttacctgccgtgccacaacttcagccggtacc
gtagaaacatccgccaaactcatcgtcaaaaagagaaaagaagctcattacgcaatccct
gcggaaacgactgctagtacaaaagtagatactaaacttgcgaaagaagatatagtttta
agatcacttgacgaaaatggattgccacttgagatacaacttcaaccaggtgatgaatcg
ttgccttggagaaaaggacgtgtttatcatcgacctcaaactagccaaccgcttccatgg
cgaaaagtaaagccaaaatcgagagattcctctttggataagcttcgagcttttgagagt
caaataaaaccatggaccgaggaagaagtagttttgaagaaaacttctcagattcctaaa
gatataacaaaagaaaagttagaagaagttgaactgaaaccaaccaagatcgagaagaaa
gaaatccatggacctagtcttgaaactgtcaagttgaaatccgtgcctaaagatacaaca
aaagctatattaaccgaagaagacgttactcgtaaagatactactacaacagaattgtac
acagaggaaactgacgcttctctattaaaatcgttgcgccacttgaaagaaactatatca
aaacaagagaaaacaaaaccatggacagaagaacaaattgttttaaagaaaataaaacca
aaaacaacaaaagtttcggaaatagatactttagaaagaacagattatacagaacaagaa
gatagttctttgcttacaatttcaaaagatgaagagacgcaaaaaataaagaaggagaaa
cttataatagataagacagaacaccctaaaccttggacggaagaaaaaatagctctcaaa
aacgcacaaccagaaagaaaagaaatatttaaacaaacgctcgaaactgttacattaaaa
ccttcgcatatagtaaaaaaagaaatagtaaaaccaacattaaaagaagtagatcttaaa
tcaattttaaaagaagaatctgaagtaattttaaaagaagaagttcagattgatgtttct
acagttaaaaaagaaaggagagcgagtaaagatatagataagacaattacagatcaaaca
gataaaatagaaaaaccaaaaccatggacagaagagaaagttgctttaaagaaatctaag
cctatccaaagagaaatagaaaaagaagcattggaaacggtagagttaaaaccatctaga
cctacgaagctggtagttcgaaaaccaagtttggaaaaagtagatttgaaacctgtcaca
aaagagaaagtggacacaagtattacagaaattgttaaacatgtcgactacactgaacat
gaagatacttcattacttcaagtgtcatctgaggaggtactggacactaccaaattaaaa
caatcaaaaccaagcaaaaaaccaacacaagatgtgggacaatatgttgaagaagaagat
attactttacttaagtctgagcgtgaaactacactaaacaaacaagtaaggaaacgaaaa
gaaataccagaagaaaaatcacagttaaaaccatggacagaagaaaaagttactctgaag
aaaacgaaacctgaacaaaaagaaatacataaagaaactctagaagaaatattgttaaaa
ccagtaacaaaagtagataaagtatcacaaaaacaactaatagaaacaacagatctggaa
catgttagaacagaaatcacggacttaactaaagttaaaaagtctgaagaaaacctatct
tatcaagaagaagaagaccaaactattcttgaaatggataaacatgttgaatactctgag
aaaataaaacctaagaaaaaagacattggaaaagtaccatacaaggaagaagaagatatt
gcaatccttgccgttgatcaaacaacagatacacaatctacaaaaaaagaaatacccata
ccatgggtaagaggaaaaaaaggaaagaaagacgtagaagaaatacaaccatctcgaata
cctacacctcaagataaaccagaagaagatcaaccaacagaaattgcagaagcatcatgg
cgtcgcaaaccaaaaccatcaaaaattcaaaaagaaattgaagaaactgtgctcaaagaa
cacgaagtagaagaaaaagctgaattaccatggaaacgtaaaaaacagacaccagttatt
aaaccagcagaaaaaccagaggaaaaacctgaagaagttcgactaaaaccagtcaaaaga
attgagaagccagaagaaccaaaaccggaggaagtaattctgaaaccggttaagaggctt
cctaaagaggaagagacaaaagaagaaattaccttaaaaccggtggaaaggaaaaaacca
gaagaaaaacctgaggaagttcgacttaaacctgtcagaagaattgagaagccagaagaa
ccaaaaccggaggaagtaattctgaaaccggttaagaggcttcctaaagaggaagagaca
aaagaagaaattaccttaaaaccggtggaaaggaaaaaaccagaagaaaaacctgaggaa
gttcgactgaaacctgttaaaagacttgagaagccagaagaaccaaaaccagaggaagta
attctgaaaccggttaggaaggtttctaaagaagaagagacaaaaggtgaaattgtgttg
aaaccggtagaacctgtcgaagataaaccgaaagaaacagcagttccttggcgacgtggt
aaacgaacaaaaaaggttgtcgacttcaaggaagaagttacaatagtgccaatcgatcaa
gaagaatcagttgcagaaatttctgaagaaaaagaaataagtgtaattacaactgaaact
atccaagatcaaaccgaaaaagaagtggacattgttccagtatctaaagaaggagaaaag
gtaactgaaatggttgaaacaagtatggtttcatggagaaaaaagaaacaagatcaaacc
agaagaggagaaaaagaaaccgtgaaaataaagctcatggaacaagttaaggaatcaagt
gttaagcagcctgaagaatatataccagtctcaaataaagatgagatattaactgagata
gttgaaaaagaaaaaattacattaaaaccaatatctaaaaagaaaataaaggaagaagac
gtagtggaagaagttacattaaaaacagtaagagaagaaaagatcacggaagaaaaactt
aaagaaaaaattattgaaggacctcaaattaaaaaacaagcagaagtatcagaagaaaga
gaagaaactcttattgaattgattaaaagaaaacctaagaaaatagaaaaagtacctaaa
gaaattgttcctattgttgaagaagaaaagcaagaagttatcacaaaaactgaaaaaatc
gaggacattgttgaagatgtcgaagtgcaagttaagaaagatatcacgcaaatagaagat
cgaaaaagaaaacgcagacaacgtactcaagtcgacatatcaattatggacaaagacaaa
actattgctccacgatttatccaaaagttgcagcccgttattgctgagctagaaaaacct
gccaagtttacttgtactgtcataggaaatcctactcctgaaatttcttggtataagaat
gaacaagaactccatgcaagtgaaaaatatataatgacgatatttgaaacaacagcaact
ttagaaattacaaaagtaaaagaggaagatgcggcaatgtactcttgcagagcgtctaat
ccggctggagtggcaacatccactgtcaatcttgtgatatatgaaaaagaagaggaaggt
gtagcaccgcattttgcaaccccgattaaacctataatggttgaagagcacacacctgcc
ctgttagaatgtgttgtaactggtacaccagtaccagaagtaaagtggtataagggtgaa
aaagaagtaaagccaaacgaaagaactgaaataaccttcaatccgacaaccggagaagct
acgcttaaaattatagaaccaatatcagaagatgaaactatttatcgtgttcgtgctgta
aataaatacggtcgcgctgaatgtagagccaatttagtgatcagtaacattgtcaaagta
agcaaaccagctgttcttagagcaccacgaattacacgacctttacctgctctcatagcc
gaacgcggaaagcctctgaaacttttggctgacttcgaaggtataccgaaaccagaagtc
aagtggttccgcaatggtattgaaattataccaaccaacaaaaacgagataaaaatctac
gagaatacaaccgaactgattgtatctgatgttacaaagaaggacagcggcaagtatgaa
attagagtccaaaatgaagtcggtgaagcgagaagttcgagttctataactgttaaagag
cgtaaagatactagcgaagtgaaagcacctagatttgtagaaccaattcagccccaactt
gtagcagaaggagaagttgttatcatggaaacaaaagtagaatcttatccggcagcatct
ttccaatggttccacgaaagcaaacttcttgagtcaacaccacaagtaaggattgtgact
caagagaatcgatcaattttaatggtaaaggaagttacaccggagcttgccggtagctac
acttgtcgtgctgaaaatgttggtggctctgtcacctgtacagctgttgttaacatcata
gatacaacatgggaagaagcagttgaattggtttcaccaacattcgttaagaggctatcg
cccgtaagagttatggacggtgagagtgttaatttaacttgcgtcgttgaaggaaaaccg
acacccagagtagaatggtatcacaatgacaaaccaattaaagaaggtaaagaaattaca
attgtccaagacatggaaggtgtctgcagtctagctattaccgaagtattccctgaagac
gctggcgaatatacatgtcgcgctataaatcccgttggcgaagccgtctgcatgtcatca
cttgttgtggaagcttacgagtatgtgcctgactcagaaattgcatcttcgatagttgca
acatctcttactacaggatcagaagaagatcttttatctccaaaagaaatcgatactgat
gtagaagaatcagcaccagagatagttaaaaagcttcctcagttagttcctattaaagat
ggggaattaactagattggaagtaaaagtgaaaggtaaaccgaaaccgaaagtgaaatgg
tacaaacaaggcacagaaattgtaccttcacaagaattcttaattgaggaatttgaagat
ggtacgtcggtattaacaattgctgaaacttttcctgacgataccggtgaaattgtattt
gaagctcacaatccacttggtgtatcgactactatgacatatttatcagtagaaggtata
cttggaacaaaagaatatcgtaagccagaatgggtcacacatatggaagaaatgcaagag
gccttaagagccacgcaagctgtaccccgaattgtccaagaaacaacagatgtttacacg
cgagaaggagatactgcagtatttgaatgtgtctactctggtaatcccaaaccagatatt
atttggtataaaaatgataagatcataatgaacaccgagaatgtgaaagtgcgtatattt
gaaaacgaaaacagaactactttaacgataaaacgacctaccaaagaagacgaagctaca
tacatctgcaaagctaccagtgaaattggcatgataacaacaaaagccaaactgcgtgtt
gaaagtgtaagtgactttggactagcaccggaagagaaggtaatcgaagaggaaaaagta
gaaataaagttgaaaaaagaagagaaaccacataagaaaaagaaacccgaattaaagaaa
gcaaaagaagttaaggagaaaataaaggctgaacgtatcacaattgaaaaagacaaaatt
catgaagaaaagcccgtatcaaaggaacagccagaagaaaaaaaaattgtccgtattgaa
gaaactcaagtattggaaaccaccgaaatcatagaagaaaagcccgaggagatttctaga
gcacgaaaaatagtaccaattcaagaaccacttataaccgaggcaacagcatctttgaaa
aaaattgatgatcagaaaactcaagaaattgtaccacaagttgaagaacgagccaagcaa
attgttgaagagcgagaaagtgttgttgtgtcagaaatccgaagcgaagatgtcgctccg
gactttaccattgaaacaaagcttgatcgcgcacaagtcatttcggaacctttacaggaa
gtctcgatctccgaaactcatgtcgaaactagaacgcaagaaacaaaacgcacagaaacg
aagaaaaaagcgaagaaagtaaaagcagaaaagattaaagaagatattattgttatggag
attgtagaacgacagaaggagaatatagctcgagaagtagatgaaatcatggagttactt
gatgtgaaagagtttggtccaggtgaatcacctcttcgagaactcgcgacagttggttac
ttggttagacaaggcgtttctgtgaacgaaatcaacgagtgcctttacagaactgagatt
tttcccgctttgaaaacacctgatgctcaaaacgctttggttcaattagtagaaagaaag
ggttacggtgctttaatcacacaagtgcttaccgaagaaacgacgactgatgagagtttt
gtcgcagcaactgtcggttttcgtgcctttatgagaatggtcgaattgcaacatgctacc
gtagaagaagtcatcacgcactttgctccggaagacttcaggccacgtgcttgggaagtt
acagaaatttccgaggttgaaactgaacaacatgctacggaaagagttgattatgttcgt
aaaacagaagttcattttatggagagaagagacgaaaggaaaactacacaagatattcaa
gaaattaaaggttcggaacaacgagtttcgatgcatggaatctattcacatgatctttta
tcttga

DBGET integrated database retrieval system