KEGG   Pseudomyrmex gracilis: 109859923Help
Entry
109859923         CDS       T05003                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pgc  Pseudomyrmex gracilis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pgc04131]
    109859923
Membrane trafficking [BR:pgc04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109859923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N AAA_25
Motif
Other DBs
NCBI-GeneID: 109859923
NCBI-ProteinID: XP_020294243
Position
Unknown
AA seq 1988 aa AA seqDB search
MSSVQRAFAHKLSKQHAADVRRQIATSTSYSRDLSKSGSSISGFSSTMSLCEILEPLDYE
DFLTQHQSVLDRDPLKPILDFPPGDVELRVINRKIRTEEPVIPHESLDTVSPYVKRCIES
FTSDWVVIHRKYKGRISPIARDRLLQDTPRQDFEVDQEDANGCGSPSEDDDLSNCGDTPR
GSWASLDLRHSQHDPLLPSLLDRVCLETIDQMNEEKRLEDRQEALFPLYAPPTSPDDEWQ
EISVAPEPTEPFAHKILVKCLQLKLELEVEPIFAILALYDAREKKKVSENFYVDMNSEGL
KRMLVNHIAYSDASTLARSCVLSISKPSPDLFLVVRLEKVLQGDISECAEPYLREDKNKD
KVKAAAAAACDRLGRYRMPLAWTAIHLSGVIGGGGDTDSTGSAGSLDRKSGSLEQWRKKV
EPPTRRGSLERRSSDKRRSWSPDDFANCLDSFRPITLTVSSFFKQESERLRDEDLYKLLV
ELRRPGSNLKRLKCLPGILKLDLSPKPEDLPRCLDPDLRKLVPYPDEKSRPVKEILEFPS
EIVSPDLTYRNLLYLYPKEANFSSRTGSARNIAVRIQLMGGEQEADALTAIFGRSSCPEM
THEYFTSVSYHNKNPSFYDEVKMRLPADLSAKHHLLFTFYHISCQKKAEQPNVETAVAYT
WLPLLRDGHLQSGEFSLPAMLDPPPANYSYIAPDVLLPGTRWVDAHRGVFTVILEPVSSV
HPQDKYIDRFLSLCGFLETGQVPPRIGEAGMESELKSALLELARASHSALVRSLPQLLDQ
LLCLLVRPPTLPSQSLNVAATIFEALGLLVRNITNLPDGQLDAHGRHALLATYIAYQCSL
PSMTHGGGVVRAQSNPDLPLEDLEMEIHSRGLDRTASMRQEFPSINNQTTRRLLHEELAL
HWVVSTGQARELAIIHSWFFLELIVRSMVVTLSEVGSLEAPRKLRFSPQFCDDVATLTAA
LTSEVISRCGKEIRVASNLISSLGNFLSDLLSVMDRGFVLSLLRAACCSLSDASMHIPDS
AALFALKLDLVRTVCSHEHYVALNLPFGTGYTSGSAPASPSPSTGSSGSLISTLVPGDKA
RFSELSQEFRQQHFLVGIVLSDLANTLEIPNPMLQNKAIGTVRHLMSCHDADSRYSDPAA
KARVAALYLPLLSILMDALPQLYHWDSKDKSVYSDESGSITQSVALAIAGGASADTAGNQ
CRVSLSSEATRHLLMCVLWVLKGLERTALAQWCSELSARRILSLLQVLNIATAAFEYKGK
KALKRLPPQAAVTSDIRSRLEDVILGQGSARSEMMLRRKERITGDKLRWRKDQMPYRSCE
QPEGRAVEQDAHIEGALAAEASLVVLDTLESVVQADGGGGAVVGAVLKVLLRALARNQST
SVLQHMFNTQRALVFKYHSALFDEESERCGDLCLTLLTRCSSPLSAIRSYAAASLYLLMR
QNFEIGNNFARVKMQVTTSLSALVGRGRAPSEGALRRALKTVLVYAERDTELADTSFPEQ
VKDLLFNLHMILSDTVKMKEFQEDPEMLLDLMYRIAKGYQGSPDLRLTWLANMAQQHMER
KNHTEAAMCLVHSAALVAEYLHLLEPGGGGRPVGAVALSAVTPNALEESAVGDDVLARRE
EGLCLGPDFSESGLAGLLEHAASSFHAAGMYEAIPDVYRVLLPIAEAAHDYKKLANIHGK
LHEAYTRVEQLAGKRVFGTYFRVGFYGARFGDLAGEEFVYKEPTLTKLPEIFSRLENFYA
ERFGADNIVIIKDSNPVDPSKLEPDKAYVQITYVEPYFEAHELRHRPTVFHRNFNIKRFV
YATPFTPGGKAHGELREQCKRKTILTVATHFPYLKTRIRVVARKQIVLSPIEVAIEDIQK
KTAEVAAATAQEPPDAKMLQMVLQGCIGTTVNQGPAEVAVVFLSGLREQNAQPTRLQHKL
RLCFKDFQKKCLDALRRNKNLIGPDQRDYQRELERNYQRLTERLASLIAWSGPSIINQQA
ATATSPRW
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggttcagcgtgcatttgctcacaaattaagcaaacaacatgctgctgatgtg
agacggcaaattgccacttctacttcctattcgcgtgatttgtccaaaagtggtagcagt
atatcaggcttttcatctacgatgtctttatgtgagatattagaaccacttgattatgaa
gacttcttaacacaacaccaatcagtattggatcgtgatcctttaaaaccaatattggat
tttccaccaggagatgttgagctgagagttataaatagaaagattcgtacagaagagcca
gtaattccacatgaatcattagacaccgtgtcaccttatgtaaaaagatgtattgaaagt
tttacatcagactgggtcgtaatacatcgtaaatataaaggaagaatctcacctattgct
agagacaggttgcttcaagatactcctagacaagattttgaggtagaccaagaagatgca
aatggttgtggatcaccaagtgaggatgacgatttgtctaattgcggtgacactccaaga
ggatcttgggcaagtttggatttgcgacattcacaacatgatccacttttgccaagttta
ttagatcgcgtttgtctcgaaacaatcgatcagatgaacgaggaaaagagattagaagat
cgacaggaagccttatttccactttatgcccctccgacttctccggatgacgagtggcaa
gaaattagtgttgctcccgaacctaccgaaccatttgctcataaaattcttgtaaaatgt
ctgcagttaaagttggaattggaagtggagcctatattcgccatcctcgcattatatgat
gctagagaaaagaaaaaggtgtcggaaaatttctatgtcgatatgaattctgagggattg
aaaagaatgcttgtgaatcacatagcttacagcgatgcgagtactttagctagaagttgc
gttctgagcattagtaaacctagtcctgatttgtttctcgttgtgcgactggagaaagtg
ttgcaaggcgatatttcggagtgtgctgaaccatatttgcgcgaagataaaaataaggac
aaggttaaagctgccgcagctgctgcatgtgatcgtttgggtcgttacagaatgcctctt
gcgtggactgccattcatctgtccggtgtaattggaggtggtggcgacacggatagtact
ggcagcgctggatctttagatagaaaatcgggcagtttggaacagtggcgaaagaaagtg
gaaccaccgacgcgacgaggatcgctggaaagacgaagctcggataaaagacgcagttgg
tctccggatgattttgccaattgtcttgatagtttcagacccatcactttaactgtttca
agttttttcaagcaggaaagtgaacgacttcgtgacgaagatctttataaacttttagtc
gaactgcgaagacctggttctaatttgaagcgattgaaatgtttaccgggaatattgaaa
ttggatctcagtcctaaacctgaagatctgcctaggtgtctcgatcccgatctcaggaaa
ttagttccttatccggatgaaaagagtcgaccggtcaaagaaatacttgagtttccgagt
gaaattgtttcgccggatttaacgtaccgtaatcttctatatctttatcccaaagaagcg
aatttcagttctagaacgggttcagcccgtaatattgccgtgcgaattcagctcatggga
ggtgaacaagaagctgatgcgctcacagctatttttggtagatcgtcgtgtcccgaaatg
acacatgaatattttacttccgtatcgtatcacaataaaaatccaagcttttacgatgaa
gttaagatgagattgcctgcggatttaagcgctaaacatcacttgttatttactttctat
catatcagttgtcagaagaaagcggaacaaccaaacgtcgaaacggcggttgcttatacg
tggctcccgcttttaagagatggtcatcttcaatcaggcgaattcagcttgcctgctatg
ttggatccgccgcctgcaaattattcttatattgcacccgacgttcttctaccaggcact
cgatgggtggacgctcatcgtggagtcttcactgttatactggagcctgtttccagcgtt
catcctcaagataaatatattgacagatttttatcattatgcggctttctcgaaactggt
caagttccacctcgtattggtgaggcgggaatggaatccgaattaaaatcagctcttctc
gaactagctcgcgcttcgcattctgccttggtgcgatctcttccccagttattggatcaa
ttgctgtgccttttagtgcgtccaccgactttaccttctcagtcactaaatgtagccgcc
acaattttcgaagctctaggacttcttgtacgaaatatcaccaatctgccggatggccag
ttggatgcgcacggaagacacgcacttttagcaacctacatcgcttatcaatgttctctg
ccaagcatgactcacggcggaggtgttgtgcgagcacaaagcaatcctgatctacctttg
gaagacttggagatggaaatccattcgcgaggattagatagaaccgcctcaatgcgacag
gaatttccttcaatcaacaatcagactaccagaagacttttgcacgaggaactcgcctta
cactgggttgtatctaccggccaagcgcgcgaattagcgataattcattcctggttcttt
ctggagctgatagtacgctcgatggtcgtcacgttgtccgaggtgggctccttggaagct
ccacgaaagctgagattctcaccgcagttttgtgacgacgttgctactcttactgccgcc
ttgacatccgaagtgatatcgcgttgcggaaaggaaattcgtgtggcgtctaacttgata
tcgagtctgggcaatttcctgtctgatttgttatccgtgatggaccgaggatttgtgctc
tcgcttcttcgcgccgcttgctgctctttgtcagacgcatcaatgcatattcccgattcg
gctgcgttgtttgccttgaaacttgatcttgtgagaacggtgtgctcccatgaacattac
gtagcattgaatcttccctttggcacagggtatacatcaggatccgccccggcatcgccc
agtccatcgaccggcagctcgggcagtctgatctctactcttgtgcccggagataaagcc
agattctcagagctcagccaggaattcaggcagcagcatttcctggttggtattgttctg
tctgatttggcaaacaccttggagataccaaatccgatgctgcagaataaggctatcgga
accgttcggcatcttatgagttgccacgacgccgattcgcgatattccgatcctgcagcg
aaagccagagttgccgcattgtatctaccgttgcttagtattctaatggatgccttaccc
cagctttatcactgggactcaaaagacaaaagcgtttattcggacgaatccggatcaatc
acgcaatcggtagctctggccattgccggcggagcgtcggcagacacggccggcaatcaa
tgtcgtgtgtccttgagctccgaagccactcgacacttgttaatgtgtgtcttatgggta
ctcaagggtttggagcgaaccgcattagcacagtggtgctctgagctcagtgcgcgacgt
atcctaagcttgctgcaagtgctgaacatcgccaccgcggctttcgagtacaaaggcaag
aaagcgcttaaaagattaccgcctcaagccgcagtcacgagtgatattagatctcgactg
gaagatgtaattcttggtcagggaagtgccagaagcgaaatgatgcttcgacgaaaagag
agaataaccggcgacaaattaagatggcgcaaagaccaaatgccttatagatcttgcgaa
caaccggaaggaagagctgtggaacaagacgctcacatagaaggagctttagcggctgaa
gcttctcttgtcgtattagacactttggaatctgtagttcaggctgatggcggtggaggt
gcagttgtcggagcagttttaaaagtgctattacgagctctggctagaaatcaaagtaca
tcagtgcttcagcatatgttcaatacacagcgagctttagtcttcaagtatcatagcgca
ttgtttgacgaagaaagcgagcgttgtggagatttatgtttaactttgcttacacgatgt
agctcgcccttgagcgctattagaagttacgcagctgcgagtctgtatttgctaatgcga
cagaatttcgaaattggaaataattttgcgcgtgtcaaaatgcaagtcacaacctcttta
tccgctctcgttggaagaggaagagctcctagtgagggagcattacgcagagcgttgaaa
acggtattagtatacgccgaaagagacacggaacttgcggacacaagttttcctgaacaa
gtaaaagatctcctatttaatctccatatgattctttccgatactgttaaaatgaaagaa
tttcaagaggatcccgaaatgctgttagatctaatgtacagaattgccaaaggatatcaa
ggatctcccgatcttcgactgacttggctcgcaaacatggcgcagcagcatatggaaaga
aaaaatcatacagaagctgcaatgtgcttagtacatagtgctgctttggtagcagaatat
cttcatttattggaacccggtggtggcggccgacctgtaggagctgttgctttgagcgcc
gtaacaccgaacgctctagaagaaagcgctgtcggcgacgacgtactagcaagaagggaa
gaaggactttgtttaggtcccgacttttccgaaagtggattagcaggattattggagcat
gcggctagctcttttcacgcagctggcatgtacgaagctattcctgacgtttacagagtt
ctgttgcctatagccgaagctgcgcatgattacaagaagttggctaacatacacggtaaa
cttcacgaagcgtacacgcgcgtggaacagttggccggcaaacgcgttttcggaacctat
ttcagagttggtttctacggcgctagatttggcgatctcgctggcgaagaatttgtttac
aaagaaccgacgttaacgaaactcccggagatattttcgagactcgagaacttttatgcc
gagcgattcggcgcagacaatattgtcataataaaagattctaaccctgttgatcccagt
aaactggagccggacaaggcttatgtacaaatcacttatgtagaaccgtattttgaagca
cacgagctcagacatagacccacagtctttcatcgaaatttcaatataaaacgatttgtt
tacgcgactcctttcactcctggcggcaaagctcatggtgagctacgtgaacagtgcaaa
aggaagacaatattaactgtagcaacgcattttccgtatctgaaaactagaattcgcgtt
gtagctcggaagcagatagttttgagtcccattgaagtagcgattgaagatatacaaaag
aaaactgccgaagtagctgcagcaactgctcaagaaccacctgatgcaaaaatgctgcag
atggttcttcaaggttgcattggcacgactgtcaatcaaggacctgccgaagtagcggtc
gtgtttctgtctggtttacgcgaacagaatgcacaacccactagactgcagcacaaactt
cgtttatgtttcaaagatttccagaagaagtgtctcgatgctttacgacgcaacaagaat
ctgattggccccgatcaaagggactatcagcgggaactggaaagaaattaccaaagattg
actgaacgactagcatctctcatcgcttggagcggaccatccataattaatcagcaagct
gcaacggcaacttctccgcgttggtag

DBGET integrated database retrieval system