KEGG   Pseudomyrmex gracilis: 109860814Help
Entry
109860814         CDS       T05003                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00010  Glycolysis / Gluconeogenesis
pgc00562  Inositol phosphate metabolism
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109860814
   00562 Inositol phosphate metabolism
    109860814
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109860814
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109860814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109860814
NCBI-ProteinID: XP_020295746
Position
Unknown
AA seq 478 aa AA seqDB search
MRNNSLLLVISLLIFSSVYVFTRDVDFCFADEDDPYLYMATKTAYHFVHGGKTRFQTIPH
CRPVQIWMVAAHGTRCPTRDEIDKIVGLTSLKEQIIHNHDVRGDGHMCNRDLENLRRWYP
NAYLVPERAEVLTPQGVEDMKLLARRLQSNFPELLQPNDSNITATNYKFQTAGARESLMS
FMEGLFGSRHAVSYEETSNNDTLLTTYKTCALWENVKSEDQSTKSTERNNFENGSEFQNL
LKNVSRRLGFKYDISIDLINAMYDTCRYEKAWTVTTLSPWCAVFSKEELYILEYREDLDY
YYKAGYGRDINARLGCPLLHDMMKHFWNIAHNKISEEPTGIFYFSDVVALQNLLTIIGIN
EDHDQLTAYNFRDMAKRQWRTSLISSFAANLVAVFYKCNEGFNRNKVMFYLAEKLVRYNG
CQVGLCDWEFLKGQFSQLAHNCKLDVCWEPNKASSSLSSYVIILLTCFSLVHGLASYH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaataattcgttactgctggtcatatcgctactgattttttcgagcgtttacgtg
tttacgcgcgatgtcgatttctgctttgcggacgaagatgatccgtatctgtacatggca
acgaagactgcctatcattttgttcacggcggcaaaacccgatttcaaactataccgcac
tgtcgaccggtgcagatctggatggttgctgcacatggtacaaggtgcccaactcgcgac
gaaattgacaagattgtcggattgaccagtcttaaggagcaaataatccataatcacgat
gtacgtggcgatggtcacatgtgtaatcgtgatctagaaaatctacgaagatggtatcca
aatgcttacttggtgccggaacgggcagaagttttgacgccgcaaggggtggaggacatg
aagctacttgccagaagattgcagagcaacttcccggagttgttgcaacctaacgacagc
aatatcacagctaccaattacaaatttcaaactgccggagcacgtgagagcctgatgtct
tttatggagggtttatttggaagcagacacgccgtatcttacgaagagacttccaataat
gacactttacttactacatataaaacatgcgctttgtgggaaaatgtaaaaagcgaggat
cagtcgactaaaagtacggaacgtaacaacttcgaaaacggatcggaatttcagaatctt
ttgaaaaatgtcagccgacggctcggttttaaatacgatatttctattgacttaatcaat
gctatgtatgacacatgtcgatacgagaaagcttggaccgttaccacactttcaccttgg
tgcgccgtttttagcaaggaagaactttatattctagaatatagagaggatctcgattat
tattacaaagctggctacggacgggacatcaatgctcgattgggatgtcctttattgcac
gatatgatgaaacacttctggaatatagcacataacaaaatctcggaagaaccaactggc
atcttttactttagtgatgtagtcgctttgcaaaatctgctgaccataataggcataaat
gaagatcatgaccaattgactgcctacaacttcagagacatggcaaaaagacaatggcgc
acatctttgatatcttcttttgctgcaaatcttgtagcagtattttacaaatgcaacgaa
ggctttaatcgtaataaagtaatgttctatctggctgaaaaattggtacgatacaatggc
tgccaagtaggtctttgcgattgggagtttctcaaagggcaatttagtcaacttgcacat
aattgcaagttagacgtttgctgggaaccgaataaagcatcttctagcttatcgagctat
gtaattattttactaacgtgtttctctctagtccatggtcttgcaagctatcattaa

DBGET integrated database retrieval system