KEGG   Pseudomyrmex gracilis: 109863321Help
Entry
109863321         CDS       T05003                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase pitchoune
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pgc  Pseudomyrmex gracilis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pgc03041]
    109863321
   03009 Ribosome biogenesis [BR:pgc03009]
    109863321
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109863321
Spliceosome [BR:pgc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    109863321
Ribosome biogenesis [BR:pgc03009]
 Eukaryotic type
  90S particles
   Helicases
    109863321
  Pre-60S particles
    109863321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ERCC3_RAD25_C AAA_22
Motif
Other DBs
NCBI-GeneID: 109863321
NCBI-ProteinID: XP_020299154
Position
Unknown
AA seq 595 aa AA seqDB search
MSVPEKILMRKMKKRERTKLKILKQREEQKDTESKLEKTDPQQHIKDSSSNEKKKKNAVK
DVTEDVNQEVTTDTDKITKDLPGTDKGLEVINDTSFSTLEGKVCENTLKAIQDIGFTNMT
EIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIELIYKLKFMPRNGTGCIIMCPTREL
AMQTFGVLKELMKYHYHTYGLLIGGTNRQAEAQKLGKGINFIVATPGRLLDHLQNTPDFL
YKNLQCLIIDEADRILDIGYEEELKQIINILPKRRQTMLFSATQTQKVAAITKFALKKEP
IYVGVDDDKEMATVEGLQQGYVMCPSEKRFLLLFTFLKKNRKKKMMVFFSSCMSVKYHHE
LLNYIDLPVMSIHGKQKQTKRTTTFYQFCNASSGILLCTDVAARGLDIPDVDWIVQYDPP
DDPKEYIHRVGRTARGEGSSGNALLILRPEEIGFLRYLKEARVPVNEYQFSWNKIADIQL
QLEKLISKNYFLHQSAKEAFKNYVRAYDSHHLKQVFDIETLDLAKVAKSFGFTVPPAVDL
KVGISKASRSRKRLGGGGYGQFNNMNDPSAAKRMKRTKTFRHINKPGQDNRQFGR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcccgaaaaaatattaatgcgaaagatgaagaagcgggaaagaacaaaattg
aaaattttaaaacaacgagaagaacaaaaagatacagaaagtaaattagagaagacagat
ccccaacaacatataaaagacagttcctcaaatgagaaaaaaaagaaaaatgctgtcaaa
gatgtcactgaagatgttaatcaagaagttactactgatactgacaagatcactaaggat
ttacctggtacagataagggtctcgaagtaataaatgatactagtttctctactttggaa
ggaaaagtatgtgaaaatactctgaaagcaatacaagatataggtttcacaaatatgaca
gagatacaagcaaaagctatcccacctcttttggaaggaagagatctagttggtgctgct
aaaacagggtcgggcaaaactctggcatttttaattcctgctattgaactgatctacaaa
ttgaaatttatgccacgcaatggtaccggatgcatcattatgtgtccaacaagagaatta
gccatgcaaactttcggagtcttgaaagaattaatgaagtatcattatcacacatatggt
ctactgattggtggtactaacagacaagctgaagcgcaaaaacttggaaaaggcatcaat
ttcattgtggctacaccaggacgattgttagatcacttacaaaacactccagatttttta
tacaaaaatctacaatgtctgataattgacgaagctgatcgtatactggatattggatat
gaagaagagttgaagcaaattattaacattcttcctaagcgtcggcagaccatgctgttc
agtgcaacgcaaacacagaaagtagcagcaataacgaaatttgctctgaaaaaagaaccc
atatacgtgggagttgacgatgataaagaaatggcgactgtggagggtttgcagcaaggc
tatgttatgtgtccgagcgagaagagattcttgcttttgtttacgtttctgaagaagaac
aggaaaaagaagatgatggttttcttcagttcttgcatgtctgttaaatatcatcacgaa
cttttgaattacattgatttaccagtgatgagtatacatggtaaacaaaagcagactaaa
agaaccacgactttttatcagttttgtaatgcttcttctggaattctgctttgcaccgat
gtagctgcaagaggtcttgatatacctgatgttgattggatcgtacagtacgatccaccg
gatgatcctaaggaatatattcatcgtgtaggtcgaaccgctcgcggagaaggcagtagc
ggtaatgcattgcttatattgcgaccagaagaaattggttttcttcgttatcttaaagaa
gctcgtgtccctgtaaatgaatatcagttttcgtggaataaaattgccgacatacaattg
cagcttgagaaactgatttcgaaaaattatttcttacatcagtcagcaaaggaagcattc
aaaaattacgtcagggcgtatgactctcatcatttgaaacaggtttttgatatagagact
cttgatctggcaaaggtcgcaaaatcattcggatttaccgtaccaccagcagtagatttg
aaagtaggaatcagtaaagcttcacgatctcggaaaagacttggtggaggtggttatgga
caatttaataatatgaatgatcctagtgcagcaaaacgaatgaagcgaaccaagacattc
cgccatataaacaaacctggacaagacaatagacaattcggcagataa

DBGET integrated database retrieval system