KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_03502Help
Entry
Gal_03502         CDS       T02968                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00071  Fatty acid degradation
pgd00072  Synthesis and degradation of ketone bodies
pgd00280  Valine, leucine and isoleucine degradation
pgd00310  Lysine degradation
pgd00362  Benzoate degradation
pgd00380  Tryptophan metabolism
pgd00620  Pyruvate metabolism
pgd00630  Glyoxylate and dicarboxylate metabolism
pgd00640  Propanoate metabolism
pgd00650  Butanoate metabolism
pgd00900  Terpenoid backbone biosynthesis
pgd01100  Metabolic pathways
pgd01110  Biosynthesis of secondary metabolites
pgd01120  Microbial metabolism in diverse environments
pgd01130  Biosynthesis of antibiotics
pgd01200  Carbon metabolism
pgd01212  Fatty acid metabolism
pgd02020  Two-component system
Module
pgd_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gal_03502
   00630 Glyoxylate and dicarboxylate metabolism
    Gal_03502
   00640 Propanoate metabolism
    Gal_03502
   00650 Butanoate metabolism
    Gal_03502
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gal_03502
   00072 Synthesis and degradation of ketone bodies
    Gal_03502
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gal_03502
   00310 Lysine degradation
    Gal_03502
   00380 Tryptophan metabolism
    Gal_03502
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gal_03502
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gal_03502
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Gal_03502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgd04147]
    Gal_03502
Enzymes [BR:pgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gal_03502
Exosome [BR:pgd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gal_03502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHD11216
UniProt: V9WJH7
Position
3555778..3556998
Genome map
AA seq 406 aa AA seqDB search
MPHLHTLRQTYEEREMTDIVILDGARTAIGTFGGSLAGTTPIDLATVASKAAMERSGVAP
EQIGNVVFGHVINTEPRDMYLSRVAAMQAGIPNGTPAMNVNRLCGSGAQAIVSGIQSLML
GDAEFALTGGAENMSRSPFIVPSARWGQKMGDARALDMMLGALNCPFGTGHMGVTAENVA
DEHDITREQMDEFALASQTRAAAAIEAGYFASQITPVDVKVKRDMVPFEVDEHPKTSTLE
TLGGLKAVFKKDGRVTAGNASGINDGAAAIVMATADAAQKAGLKPKARILGYAHAGVRPE
VMGIGPVPAVQNLLKKTGLSASDFDVIESNEAFAAQALAVNKELGLDPAKVNPNGGAIAL
GHPVGATGAIITLKALYELERTGGSKGLITMCIGGGQGIALAIERL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatctgcatactctgcgccaaacctatgaggagagagaaatgaccgatatcgtg
atcctggatggcgcccgcaccgccatcggcacctttggcgggtcgcttgccggcaccacg
ccgattgatctagcgaccgtggcctccaaggccgccatggagcgctcaggcgttgcgccg
gaacagatcggcaatgtggtttttggccatgtgatcaacactgaaccccgcgatatgtac
ctgagccgcgtggcggcgatgcaggccggtatcccaaacggcacgccagcgatgaacgtc
aaccggctttgtgggtctggcgcgcaggcgattgtctccggcatccaatcactgatgctg
ggcgatgcggaatttgccctcaccggtggggccgaaaacatgtcgcgcagccccttcatc
gtgccaagcgcgcgctggggacagaaaatgggcgatgcgcgagcactcgacatgatgctt
ggtgcactgaactgcccgtttggaaccggccacatgggggtgacggcggaaaacgttgcg
gatgaacatgatatcacccgtgagcagatggatgaatttgccctcgccagccagacccgt
gcagccgcggcgatcgaggccggatatttcgccagccagatcaccccggttgacgtgaag
gtcaagcgggacatggtcccgtttgaggtggacgaacaccccaagaccagcacgttggag
acattgggcgggctgaaagccgtgttcaagaaagacggccgcgtcacggccggcaatgcc
agcggtatcaatgatggcgcagctgccatcgtcatggccaccgccgacgcagcgcagaag
gcggggctgaagcccaaagcgcgtattttgggctacgcgcatgccggtgtccgccccgag
gtcatgggcattggcccggttcccgcagtgcagaacctgctgaagaaaaccggattgtcc
gcctctgatttcgatgtgatcgaatcaaacgaagcctttgcggcgcaggcgcttgccgtg
aacaaggaactggggctggatcctgcgaaggtgaacccgaacggcggtgccatcgcgctc
ggccatcctgtcggtgcgaccggtgcgatcatcacgctgaaagcgctctatgaacttgaa
cgcactggcggctccaaaggcttgatcaccatgtgcatcggtggcggtcagggcattgcc
ctggcaatcgaacgtctctga

DBGET integrated database retrieval system