KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_04254Help
Entry
Gal_04254         CDS       T02968                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00260  Glycine, serine and threonine metabolism
pgd00630  Glyoxylate and dicarboxylate metabolism
pgd00670  One carbon pool by folate
pgd01100  Metabolic pathways
pgd01110  Biosynthesis of secondary metabolites
pgd01130  Biosynthesis of antibiotics
pgd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Gal_04254
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gal_04254
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Gal_04254
Enzymes [BR:pgd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Gal_04254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AHD11958
UniProt: V9WP92
Position
pGal_D78:complement(43337..44434)
Genome map
AA seq 365 aa AA seqDB search
MTDAPKRTPLYDLHVALGGKMVDFAGWEMPVQYPMGIMGEHKQCREKAALFDVSHMGQVI
LRGDNVGEKLEAICPQAYATLKEGKARYGFFTNEDGGIMDDLIVSNAGDHYFVVVNAALR
HQDIPHMKAHLDGVEVTEIFDRALVAVQGPAAENVVGDLCPAAREMKFMETIVADIDGVE
CRLSRLGYTGEDGYEISIPDADAERITKLFLAHEDCEPAGLGARDSLRLEAGLCLYGNDI
DQSTSPIEASLAWAIQKRRKEEGGFPGADRIQKELADGAAKKLVGIKPSGRAPARQHVEI
QCAEGNTIGEITSGCFGPTVGGPVAMGYVAAPHGKAGEQVKLIIRGKAHDAEIVALPFVT
QNYKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgccgaaacgtactccgctctatgacctgcatgtcgccctcggcggcaag
atggtcgactttgccggctgggaaatgccggtccaataccccatgggcatcatgggagag
cacaagcagtgccgcgagaaagctgcgctgttcgatgtcagccacatgggtcaggtgatc
ctgcgcggcgacaacgtcggcgagaaactggaagcgatctgcccgcaggcctatgccacc
ctcaaggaaggcaaggcgcgctatggtttcttcaccaatgaagacggcggcatcatggat
gacctcatcgtctccaacgctggcgaccattatttcgtcgtggtgaacgcagccctgcgt
catcaggacattccccatatgaaggcgcatctcgacggcgtcgaagtaactgagatcttc
gaccgggcactggtcgctgttcagggtcccgccgccgaaaacgtcgtaggcgatctttgc
cctgctgcccgtgagatgaagttcatggaaaccatcgtcgctgatatcgacggtgtggaa
tgccgcctgtcacgcctcggctacaccggcgaagatggctatgagatttccattcccgat
gcagacgccgaacgcatcaccaaactgttcctggcccatgaggattgtgagccggctggt
ctaggcgcgcgtgacagcctgcgtctggaagccggtctttgcctctatggcaacgacatc
gaccagtcgacctccccgattgaggcgtcgctggcctgggcgatccagaaacgccgcaag
gaagaaggcggcttccccggtgccgaccgcatccagaaagagctggccgacggcgctgcc
aagaaactggtcgggatcaaaccctccggtcgcgcccctgcccgtcagcacgtcgagatc
caatgcgccgaaggcaacaccatcggtgagatcacctccggctgctttggccccaccgtc
ggcggcccggttgccatgggctatgttgcggccccgcacggcaaagccggcgaacaagtc
aagctgatcattcggggcaaggcccatgacgcagaaatcgtcgccctgcccttcgtcacc
cagaattacaaacgctaa

DBGET integrated database retrieval system