KEGG   Pluralibacter gergoviae: LG71_00090Help
Entry
LG71_00090        CDS       T03300                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00511  Other glycan degradation
pge00520  Amino sugar and nucleotide sugar metabolism
pge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LG71_00090
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LG71_00090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pge03110]
    LG71_00090
Enzymes [BR:pge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LG71_00090
Chaperones and folding catalysts [BR:pge03110]
 Intramolecular chaperones
  Others
   LG71_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2 Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: AIQ98392
Position
complement(18617..21010)
Genome map
AA seq 797 aa AA seqDB search
MLKTVRYSLLSTGLLLAGAALAAPAGDLPLMPWPSQVARPAAEGALILNNTLTVSITGDD
LGDAADRLRGRIARQTGWEMLPQPPEVKNPTIAIVIAKKVPPVPLPDSDERYKLVVDENG
VKLTANTRFGALHGIETLLQLIHNGPNNTAIPYVTIDDAPRFPWRGLLLDPARHFLPVED
IKRQIDGMAAAKLNVLHWHLTDDQGWRFASTRYPKLQQLASDGQYYTQAQMKEVVRYAAE
RGIRVVPEIDMPGHASAIAVAYPELMSAPGPYQMERRWGVLKPVPDPTKEATYAFAEAMV
SELAAIFPDPYLHIGGDEVDDSQWKNNPDIQRLMREHRLADSGALQAYFNRRLETILEKH
HRQMVGWDEIYHPDLPKSILIQSWQGQDALAEVAKNGYRGILSTGFYLDQPQYTAYHYRN
EPVPQGLDGVDNIGETESAQSWSFSMPRLKGSPVTGSFTLVKGKDEWRGFIDFSGKTRRA
VQDIEWLTPDQVTFTVDSWMGETRPVLNIHDDQIKGYFLLGNTRYPVTGSSLDEVPKGIA
PTVLSAEQEKNLLGGEAALWSENVVAPVLDIRLWPRAFAVAERLWSAKDVNDTDNMYQRL
QAIDGWSTVSVGLQQHTQQLVQFTRLANGGGTLPLQILAQALEPAHYYTRQHLKFQAGNY
TQLEPLNRLADALPAESNTVRGLDQWADNLISDPEDNESADALRHVFTRWQNNTADVMPL
TDASYLLSAIKPVVLQVDKLAALGLRLTDLVARQGTLDDKEYASLQTQLDEAAKTQDELV
IAAVYPLEKLLRATRIE
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaccgtgcgctacagcctgctgtccaccggactgctgctggccggtgccgcg
ctggcggcccccgcgggcgatctgcccctgatgccctggccctcgcaggtggcgcgcccc
gccgccgaaggggcgctgatcctcaataacacccttaccgtcagcatcaccggcgacgac
ctcggcgatgccgccgaccgtctgcgcgggcgcatcgcccgccagaccggctgggagatg
ctgccccagccgccggaggttaaaaacccgaccatcgcgatcgtcattgcgaaaaaggtg
ccgcccgtgccgctccccgacagcgacgagcgctataagctggtggtcgatgagaacggc
gtgaagctcaccgcgaatacccgcttcggcgctctgcacggcatagagacgctgctgcag
ctgatccataatggtccgaacaataccgccatcccttacgtcaccatcgacgacgcgccg
cgcttcccctggcgcgggctgctgctcgaccccgcccgccactttctgccggtcgaggac
atcaagcggcagattgacggcatggcggcggccaagcttaacgtcctgcactggcacctg
accgacgatcagggctggcgcttcgcctccacccgctatccgaagctgcagcaactggcg
agcgacgggcagtactacacccaggcgcagatgaaagaggtggtgcgctacgccgccgaa
cgcggcatccgcgtggtgccggagatcgatatgccgggccacgcctctgccatcgcggtg
gcctatccggagctgatgagcgctccgggcccgtatcagatggagcgccgctggggcgtg
ctcaagccggtgcccgatccgaccaaagaggcgacctacgccttcgccgaggcgatggtc
agcgagctggcggccattttccccgacccttatctgcatatcggcggcgatgaggtggac
gacagccagtggaaaaataacccggatatccagcgccttatgcgcgagcaccggctggcg
gacagcggcgccctgcaggcgtactttaaccgccgtcttgaaaccattctggaaaagcac
caccgccagatggtgggctgggatgagatctaccatcccgacctgccgaagagcatcctg
atccagtcctggcaggggcaggacgcgctggccgaggtggcgaaaaacggctaccggggc
attctctccaccggcttctatctcgaccagcctcagtacaccgcctaccactatcgcaac
gagccggtgccgcaggggctggacggcgtggacaatattggtgagacggagagcgcccag
agctggagcttctcgatgccgcgcctcaagggcagcccggttaccggcagcttcacgctg
gtgaagggcaaggacgagtggcgcggctttatcgacttcagcggcaaaacgcgccgcgcg
gtgcaggacatcgagtggctgacgccggaccaggtgaccttcaccgttgatagctggatg
ggcgaaacccggccggtgctgaatatccacgatgaccagattaaaggctacttcctgctg
ggcaatacccgctacccggtgaccggcagcagcctcgacgaggtgccgaaaggcattgcg
ccgacggtgctcagcgccgagcaggagaaaaatctgctcggcggcgaagcggcgctgtgg
agcgaaaacgtggttgccccggtgctcgatatccgcctctggccccgcgccttcgcggtg
gcggagcggctgtggtcggcgaaggacgtcaacgataccgacaatatgtaccagcgcctg
caggccatcgacggctggtcaacggtctccgtcggcctgcagcagcatacccagcagctg
gtgcagttcacccggctggccaacggcggcggaacgctgccgctgcagatcctcgcccag
gcgctggagcccgcccactactacacccgccagcacctcaagttccaggcgggcaactac
acccagcttgaaccgctgaaccggctggccgacgccctgccggcggagagcaataccgtg
cgcggcctcgaccagtgggcggataacctgataagcgatccggaggacaacgaaagcgcc
gacgccctgcgtcacgtcttcacccgctggcagaacaacaccgccgacgtgatgccgctc
accgacgccagctacctgctgtccgccatcaagccggtggtgctgcaggtggacaagctg
gcggcgctcggcctgcgcctgaccgatctggtggcgcgccaggggacgctggatgacaaa
gaatatgcctcccttcagacccagctggacgaagcggcgaaaacccaggacgagctggtg
attgcggcggtctatccgctggagaaactgctgcgggcaacgcgcatcgagtga

DBGET integrated database retrieval system