KEGG   Pluralibacter gergoviae: LG71_00290Help
Entry
LG71_00290        CDS       T03300                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00052  Galactose metabolism
pge00500  Starch and sucrose metabolism
pge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LG71_00290
   00500 Starch and sucrose metabolism
    LG71_00290
Enzymes [BR:pge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LG71_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AIQ98431
Position
66017..67462
Genome map
AA seq 481 aa AA seqDB search
MKQELQRAQAGVEAMRARRGSAFYPGYHLAPPAGWMNDPNGLIWFGGQYHAFYQHHPYSA
DWGPMHWGHATSEDMVHWQQQPIALAPGGEEDRDGCFSGSAVDDDGVLSLIYTGHVWLDG
EGNDSAIREVQCLATSRDGIHFEKQGEVLLPPEGIMHFRDPKVWRQDGAWWMVIGARDRH
DSGQVLLYRGSSLRNWTFDRVLAGAKPGESYMWECPDFFPLGQQQYLMFSPQGMRPAGYD
YRNRFQSGVIAGRWLPGGGFTPQSSFRELDRGHDFYAPQSFSAADGRRVIIAWMDMWESP
MPSKLEGWAGCMTVARELKEVDGELRQLPVAELLSLRRQATAIEAGTLVGERQLADGVKC
HELLLTWDTQASDAEHYGVRLGNSLRLYVDNQARRLVLWRDSPDAALDGYRSIPLPGGVL
LSLRIFFDSSSVEVFVNDGEAVLSSRIYPQEGDRALRLYAAHGEAMLCKGELWALAAIQA
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggaactacagcgcgcgcaggccggagtggaggcaatgcgcgcccgccgcggc
agcgcattttatcccggctaccatctggcgccgccggcgggctggatgaacgatccgaac
ggcctgatctggttcggcggccagtaccacgccttctatcagcaccacccctacagcgcc
gactggggcccgatgcactgggggcacgcgaccagcgaggatatggttcactggcagcag
cagcccattgcgctggcgccgggcggtgaagaggaccgcgacggctgcttctccggcagc
gccgtggacgatgacggcgtgctgtcgcttatctacaccggccacgtctggctcgacggc
gagggcaacgacagcgccatccgcgaagtgcagtgtctggccaccagccgggacggcatc
cacttcgaaaaacagggcgaggtgctgctgcctccggaggggatcatgcacttccgcgat
ccgaaagtctggcgccaggacggcgcgtggtggatggtcatcggcgcccgcgaccggcac
gacagcggccaggtgctgctctatcgcggcagcagcctgcgcaactggacctttgaccgg
gtgctggccggggcgaagcccggcgagagctatatgtgggagtgcccggactttttcccg
ctcggccagcagcagtacctgatgttctctccccagggaatgcgccccgccggctacgac
taccgcaaccgcttccagagcggcgtgattgccgggcgctggctgcccggcggcggcttc
acgccgcagtcgtccttccgcgagctggatcgcggccacgacttttacgctccgcagagc
ttcagcgccgccgacggcaggcgcgttatcatcgcgtggatggatatgtgggagtcgccg
atgccctcgaagcttgagggctgggcgggctgcatgaccgttgcgcgcgagttaaaagag
gtggacggcgaactgcgccagctgccggtagcggagctgctctccctgcgccggcaggcg
acggcgattgaggccgggacgctcgtcggcgagcggcagcttgccgacggcgtgaagtgc
cacgagctgctgctgacctgggacacccaggcaagcgatgccgaacactacggcgtgcgt
ctcggcaacagcctgcggctgtacgtggataatcaggcacgccggctggtgctgtggcga
gattcgccggatgcggcgctggacggctaccgcagcattcccctccccggcggcgtactg
ctgagcctgcgcatcttcttcgacagttcgtcggtggaggtcttcgtcaacgacggcgag
gcggtgctcagcagccgcatctacccgcaggagggcgatcgcgcgctgcggctctacgcc
gcacacggcgaggcgatgctctgtaaaggtgaactctgggcgctggcggcgattcaggcc
gactga

DBGET integrated database retrieval system