KEGG   Pluralibacter gergoviae: LG71_03165Help
Entry
LG71_03165        CDS       T03300                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00780  Biotin metabolism
pge01100  Metabolic pathways
Module
pge_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LG71_03165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pge01007]
    LG71_03165
Enzymes [BR:pge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     LG71_03165
Amino acid related enzymes [BR:pge01007]
 Aminotransferase (transaminase)
  Class II
   LG71_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 OKR_DC_1 Flg_hook
Motif
Other DBs
NCBI-ProteinID: AIQ98964
UniProt: A0A1S2B5V3
Position
663089..664264
Genome map
AA seq 391 aa AA seqDB search
MGLYDRFTRLAKDREQFQTSGINPFGTCIDEIYSATEGRIGDQKIILAGTNNYLGLTFNA
QAIAAGQAALAAQGTGTTGSRMANGSYGPHLQLEHEIAEFFDRPSSIVFSTGYTANLGVI
SALAVPGAVVLLDADSHASIYDACTLGGAEIIRFRHNDASDLERRMVRLGERARDAIIIV
EGIYSMLGDVAPLAEIVDIKRRLGGYLIVDEAHSFGVLGKHGRGLAEEVGVEADVDIIVG
TFSKSLAAIGGFAVGNKEMDVLRYASRPYIFTASPSPSSIASVRSSLKTIAQHPELREKL
WSNAHRLYEGLKALGYELGPNISPVVPVVIGSKEEGLRFWRELISRGVYVNLVLPPAAPA
GITLLRCSVNAAHSDEQIDTIIKVFADMKNQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggcctttatgataggtttacgcgccttgcgaaggatcgtgaacagtttcaaacctca
ggtatcaatcctttcggtacctgcattgacgagatctattcggcaaccgaaggccgtatc
ggcgaccagaaaattattctcgccggtaccaacaactatctcggtctgaccttcaatgcg
caggctatcgccgccggtcaggcagcgctggccgcgcagggcaccggtaccaccggttcg
cgcatggccaacggcagctacggtccgcacctgcagcttgagcacgagattgctgagttc
ttcgatcgcccttcttctatcgtcttctcgacgggctataccgcaaacctcggcgtcatt
agcgccctggccgtgccgggcgccgtcgttcttctcgacgccgacagccatgccagcatc
tacgacgcctgcaccctcggcggtgccgaaattattcgcttccgccacaacgacgccagc
gaccttgaacgccgcatggtgcgcctgggcgagcgcgcccgcgacgctatcatcattgtg
gaaggcatctacagcatgttgggcgacgtcgccccgctggccgaaatcgtcgatatcaag
cgccgcctcggcggctacctgatcgttgatgaagcgcactccttcggcgtgctcggcaaa
catggccgcggcctggcggaagaagttggcgttgaggccgatgtcgatatcatcgtcggc
accttcagcaaaagcctcgcggcgatcggcggctttgcggtcggtaacaaagagatggac
gtactgcgctacgccagccgcccctatatctttaccgcctcaccgtcgccctccagcatc
gcctccgtgcgatcttcgctgaaaaccattgctcagcacccggagctgcgtgaaaagctg
tggagcaacgcacatcgcctctatgaaggcctgaaggcgctgggctacgagcttggtccg
aacatcagcccggttgtgccggtggtgattggctcgaaagaagaaggcctgcgcttctgg
cgcgagctgatcagccgcggcgtttacgttaatctggtgctgccgccggcggcgcctgcc
ggtattaccctgctgcgctgcagcgtcaacgccgcccacagcgacgagcaaatcgatacc
atcattaaggtgtttgctgatatgaagaatcagtaa

DBGET integrated database retrieval system