KEGG   Pluralibacter gergoviae: LG71_04475Help
Entry
LG71_04475        CDS       T03300                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00010  Glycolysis / Gluconeogenesis
pge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LG71_04475
Enzymes [BR:pge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     LG71_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase Hydrolase_like HAD PerC PNK3P SHOCT
Motif
Other DBs
NCBI-ProteinID: AIQ99211
UniProt: A0A089PG47
Position
941295..941885
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVFGAWSDFARVPLATLKQKFVMGETFHQHERGEISDEAFAEK
LCHELDLPLSYEQFAHGWQAIFVGLRPEVIAIMQGLREQGHRVVVLSNTNRLHTTFWPDE
YPEVRAAADRIYLSQEMGMRKPEARIWQQVLAEEGFSAQDTVFFDDNAENIEGAKRLGIA
SVLVTDKRTIPDYFSK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgacttcaaccgcgtgttc
ggcgcctggagcgactttgcccgcgtgccgctggcgacgctgaagcaaaaatttgtcatg
ggagagacctttcaccagcacgagcgcggagagataagcgacgaggcctttgctgaaaaa
ttgtgtcatgagttggatctaccgctgagctatgagcagttcgcccacggctggcaggcg
atcttcgtcggcctgcgcccggaggtaattgcgattatgcagggccttcgcgagcagggg
caccgcgtggtggtgctctccaacactaaccgcctgcacaccaccttctggccggatgaa
tacccggaggtccgcgccgccgccgaccgcatctacctttctcaggagatggggatgcgc
aaaccggaggcgcgtatctggcagcaggtgctcgctgaagaggggttctctgcgcaggat
accgtctttttcgacgacaacgcggagaatattgagggtgcgaagcgcctggggattgcc
agcgtgctggtgaccgataagcgcaccatcccggactacttctctaagtaa

DBGET integrated database retrieval system