KEGG   Pluralibacter gergoviae: LG71_09410Help
Entry
LG71_09410        CDS       T03300                                 

Definition
(GenBank) tRNA pseudouridine synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pge  Pluralibacter gergoviae
Brite
KEGG Orthology (KO) [BR:pge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pge03016]
    LG71_09410
Enzymes [BR:pge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     LG71_09410
Transfer RNA biogenesis [BR:pge03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    LG71_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIR00097
UniProt: A0A1S2BID3
Position
1965922..1966701
Genome map
AA seq 259 aa AA seqDB search
MLEILYRDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLSQQFEQHQIQKRYHAVVRGWLTEEATLDYPLVEELDKIADKFAREDK
DPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLSHLRHPIIGDSK
HGDLRQNRSAAAHFGCGRLMLHASELSLTHPFTGEPLTIRAGFDDIWMQALSHFGWRGLL
PQMERVEFTPDSVQDGDIH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctaccgggacgaatggctggtcgccgtcaacaaaccctccggctgg
ctggtgcaccgcagctggctggaccgcgatgaaaaagtggtggtgatgcagaccgtgcgc
gaccagattggccagcacgtctttaccgcccaccgcctcgaccggcccacctccggcgtg
ctgctgatggggctttccagcgaggcgggccgcctgctgtcgcagcagtttgagcagcat
cagatccagaagcgctaccacgccgtcgtgcgcggctggctgacggaggaggccacgctc
gattatccgctggtcgaggagctggataaaatcgccgacaagttcgcccgcgaggacaaa
gacccgcagccggcggtcacccactatcgcggactggccaccgtcgagatgccggtggcc
accggacgctatccgacgacgcgctacgggctggttgagctggagccaaagaccggccgc
aagcaccaactgcgccgccacctgagccacctgcgccacccgatcatcggcgacagcaag
cacggcgacctgcgccagaaccgcagcgcggcggcgcacttcggctgcggccgcctgatg
ctgcacgccagcgagctgtcgctgacccatcccttcaccggcgagccgctgacgatccgc
gccggttttgacgacatctggatgcaggcgctgtcacacttcggctggcgcggcctgctc
cctcagatggaaagggttgagtttacgcctgacagcgttcaggatggcgacattcactaa

DBGET integrated database retrieval system