KEGG   Pluralibacter gergoviae: LG71_09595Help
Entry
LG71_09595        CDS       T03300                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00360  Phenylalanine metabolism
pge00362  Benzoate degradation
pge00621  Dioxin degradation
pge00622  Xylene degradation
pge01100  Metabolic pathways
pge01120  Microbial metabolism in diverse environments
pge01220  Degradation of aromatic compounds
Module
pge_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
pge_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LG71_09595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG71_09595
   00622 Xylene degradation
    LG71_09595
   00621 Dioxin degradation
    LG71_09595
Enzymes [BR:pge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     LG71_09595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm SOUL
Motif
Other DBs
NCBI-ProteinID: AIR00134
UniProt: A0A1Y4YAE3
Position
complement(2010799..2011815)
Genome map
AA seq 338 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLESVRRIAAALDSAGVDSIEVAHGDGLQGSSFNYG
FGAHSDVEWIEAAASAVSNAKIATLLIPGIGTLHDLKNAYQAGARVVRVATHCTEADVSA
QHIAFARELGMDTVGFLMMSHMTSPQALAEQAKKMESYGATCIYVVDSGGAMNMNDIRDR
FRALKDVLQPDTATGMHAHHNLSLGVANSIAAVEEGCDRVDASLAGMGAGAGNAPLEAFI
AAADKMGWDHGTDLLALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEAAAR
RYGLSTVDILVELGKRRMVGGQEDMIVDVALDLLGRSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactctatatctcagacgtgacgctgcgcgacggcatgcacgccatc
cgccaccagtattcgctggagagcgtgcgccggatcgccgccgcgctggacagcgcgggc
gtggattccattgaagtggcccacggcgacggcctgcagggttccagcttcaactacggc
ttcggggcgcacagcgacgttgagtggatcgaagcggcggcctcggcggtcagcaacgcg
aaaatcgctaccctgctgatcccggggatcggcaccctgcacgatctgaaaaacgcgtat
caggccggggcgcgggtggtgcgcgtcgccacccactgcaccgaggcggacgtctccgct
cagcacatcgccttcgcccgcgagctgggaatggacaccgtcggctttctgatgatgagc
cacatgacctcgccgcaggcgctggcggagcaggcgaagaagatggagtcctatggggcg
acctgcatctacgtggtggactccggcggagcgatgaacatgaacgacatccgcgaccgc
ttccgcgccctgaaagatgttcttcagcccgacaccgcgaccgggatgcacgcccaccac
aacctgagcctcggcgtcgccaactccatcgccgccgtcgaagagggctgcgaccgcgtt
gacgccagcctcgccggcatgggcgctggcgcgggcaatgcgccgctggaagcgtttatc
gccgccgcagacaagatgggctgggatcacggcaccgacctgctggcgctgatggacgcc
gcggacgatctggtgcggcctctgcaggacaggccggtgcgggtggatcgcgagacgctg
gcgctgggctacgccggagtctactccagcttcctgcgccacagcgaagcggcggccaga
cgctacggcctgagcacggtggacatcctggtggaactgggcaagcgccggatggtcggc
ggccaggaggatatgatcgtcgatgtggcgctggatctgctcgggcgcagtaaataa

DBGET integrated database retrieval system