KEGG   Pluralibacter gergoviae: LG71_14350Help
Entry
LG71_14350        CDS       T03300                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00071  Fatty acid degradation
pge00072  Synthesis and degradation of ketone bodies
pge00280  Valine, leucine and isoleucine degradation
pge00310  Lysine degradation
pge00362  Benzoate degradation
pge00380  Tryptophan metabolism
pge00620  Pyruvate metabolism
pge00630  Glyoxylate and dicarboxylate metabolism
pge00640  Propanoate metabolism
pge00650  Butanoate metabolism
pge00900  Terpenoid backbone biosynthesis
pge01100  Metabolic pathways
pge01110  Biosynthesis of secondary metabolites
pge01120  Microbial metabolism in diverse environments
pge01130  Biosynthesis of antibiotics
pge01200  Carbon metabolism
pge01212  Fatty acid metabolism
pge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG71_14350
   00630 Glyoxylate and dicarboxylate metabolism
    LG71_14350
   00640 Propanoate metabolism
    LG71_14350
   00650 Butanoate metabolism
    LG71_14350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LG71_14350
   00072 Synthesis and degradation of ketone bodies
    LG71_14350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG71_14350
   00310 Lysine degradation
    LG71_14350
   00380 Tryptophan metabolism
    LG71_14350
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG71_14350
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG71_14350
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LG71_14350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pge04147]
    LG71_14350
Enzymes [BR:pge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG71_14350
Exosome [BR:pge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG71_14350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIR01001
Position
3041696..3042889
Genome map
AA seq 397 aa AA seqDB search
MNKVAIVAATRTAIGSFQGALSPLPATALGAAVIKALLERTGIDPAAVSSVLMGQVLTAG
CGQNPARQSAIQAGLPVTTPAVTLNLVCGSGLQAIIEGARAVALGDADVVIAGGQESMSN
APYLMPGARAGLRAGHKQLQDSMIQDGLWDAFNDYHMGITAENLASRFNISREQQDAFAL
ASQQKAAAALEAGRFGDEITPLSVPAGRGKTCTVDTDEQPRTDTTAETLAALRPAFIPGT
GTVTAGNASTLNDGAAAVMLMSEARAAELNLPVLATIAGYATAGVEPEIMGFGPVPATLA
CLNKAGWTISDLELVEGNEAFAVQALVVLQALELNPGIVNVNGGAIALGHPIGASGCRIL
VSLLYEMQRRGAAKGLATLCVGGGQGVALAVERPGGE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtcgcgattgtcgccgctacccgtacggctatcggcagcttccagggcgcg
ctgtcgccgctgcccgccaccgcgctgggggcggcagtgattaaggcgctgcttgagcgc
accggcatcgatccggcggcggtcagcagcgtgctgatgggccaggtgctgaccgcaggc
tgcgggcagaatccggcccgccagagcgccattcaggcggggctgccggtgaccacgccc
gccgtgaccctcaacctggtctgcggctccggcctgcaggcgattatcgaaggcgcccgc
gcggtggcgctcggcgatgccgatgtggtgatcgccggcggccaggagagcatgagcaat
gccccctatctgatgcccggcgcccgcgccggactgcgcgcgggccacaagcagctgcag
gacagcatgattcaggacggcctgtgggacgcgttcaacgactaccacatgggcattacc
gccgagaatcttgccagccgatttaacatttcccgcgagcagcaggacgccttcgcgcta
gcctcccagcagaaggccgccgccgcgctggaggcggggcgctttggcgatgaaatcacg
cccctgagcgtgcccgcaggccgcggcaaaacttgcaccgtcgataccgacgaacagccc
cggaccgataccaccgccgaaacgctggcggccctgcgcccggcctttattcccggcacc
ggcaccgtaaccgcgggcaacgcctcgacgctgaacgacggtgccgcggcggtgatgttg
atgagcgaagcccgggcggccgaactcaatctgccggtgctcgccaccattgccggctac
gcgacggcgggcgttgagccggagattatgggctttggtccggtgccggcgaccctggcc
tgcctgaataaagcgggctggaccattagcgaccttgagctggtcgaaggcaacgaagcc
ttcgccgtccaggcgctggtggtgctccaggcccttgagcttaaccccgggatcgtcaac
gtcaacggcggcgcgattgcccttggccacccaatcggcgcctccggctgccgcatcctg
gtgtcgctgctgtacgaaatgcagcgccggggcgcggcgaaagggctggcgacgctgtgc
gtcggcggcgggcagggcgtggcgctggcggttgaacgtccgggaggtgaatga

DBGET integrated database retrieval system