KEGG   Pluralibacter gergoviae: LG71_21600Help
Entry
LG71_21600        CDS       T03300                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00520  Amino sugar and nucleotide sugar metabolism
pge01100  Metabolic pathways
pge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LG71_21600 (nagA)
Enzymes [BR:pge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LG71_21600 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIR02332
UniProt: A0A089PPX5
Position
4607500..4608654
Genome map
AA seq 384 aa AA seqDB search
MYALTEGRIYTGRDILDDHAVVVADGLIARICPQSDLPPGIEQRSLNGAILAPGFIDVQL
NGCGGVQFNDSPDAVTVETLEIMQKTNEKAGCTSYLPTLITTSDELMKQGIRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPDFVRKPDPALVDVLCENADVITKVTLAPEMVPAEV
IEKLTAAGIVVSAGHSNATLAEAKAGFRAGIRFATHLYNAMPYISGREPGLAGAIFDEPD
LHCGIIVDGLHVDFANVRNAKRLKGDKLCLVTDATAAAGADIEEFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGVALDEALRMATLYPARAIGVDKTLGRIAPGMVANL
TAFTRDYKITRTIVNGNEVVNLSN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcactaaccgagggccggatctacaccggtcgtgacattctggatgaccacgcg
gtcgttgttgctgatggcctgatcgcacggatctgcccgcagagcgacctgccgcccggg
attgaacagcgctcgcttaacggcgccattcttgctcccggttttatcgacgtccagctc
aacggttgcggcggcgtgcagttcaacgacagccccgacgcggtgaccgttgaaacgctg
gaaatcatgcagaagaccaacgaaaaagcgggctgcaccagctatctgccgacgcttatc
accaccagcgacgaattaatgaagcaaggcattcgcgtgatgcgcgagtatctggcgaag
caccctaatcaggcgctgggcctgcatctggaaggtccgtggcttaacctggtcaagaaa
ggcacccacaatccggacttcgtgcgtaaaccggatccggcgctggtggatgtactgtgc
gagaatgctgacgtcatcaccaaagtgaccctggcgccggaaatggtgccggctgaagtg
attgagaagctgaccgccgccggcatcgtagtctccgcagggcactcgaatgcaacgctt
gctgaagccaaagccggtttccgcgccggtattcgtttcgccactcatctctataatgcg
atgccctatatctccgggcgcgagccgggcctggcgggcgccatttttgacgagcctgac
ctccactgcggcatcattgttgacggcctgcacgtcgatttcgccaacgtgcgcaatgcc
aagcgcctgaagggcgataagctctgcctggtcaccgatgccactgccgccgcgggagcc
gacattgaggagttcatttttgctggtaaaacaatatactaccggaatggactgtgcgtg
gatgaaaacggtaccctcagcggttcgtcgctcaccatgattgagggcgtgcgcaacctg
gttgagcactgcggcgtggcgctggatgaagccctgcgcatggcgacgctctacccggcc
cgcgctatcggcgtcgataagacgctgggtcgcattgccccgggcatggtggcgaacctg
accgccttcacgcgcgattataaaatcaccaggaccatcgttaatggtaacgaggtcgtt
aacttgagtaactga

DBGET integrated database retrieval system