KEGG   Pluralibacter gergoviae: LG71_23955Help
Entry
LG71_23955        CDS       T03300                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00230  Purine metabolism
pge01100  Metabolic pathways
pge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LG71_23955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pge01002]
    LG71_23955
Enzymes [BR:pge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     LG71_23955
Peptidases and inhibitors [BR:pge01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   LG71_23955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIR02760
UniProt: A0A1S2BNW3
Position
5112204..5113790
Genome map
AA seq 528 aa AA seqDB search
MMHSNMAPGAMAVSPHHLASESALSVLRHGGDAIEAMVAAAATIAVVYPHMNGIGGDGFW
LIVPPEGEPVAIDASGAAGAQATLEYYAEHKAIPHRGARAALTVPGTISGWDEALKISAG
LGGGTLPLSRLLADAIRYAADGIPVTPSQASATRDKYHELSGVPGFANAFLQRGDIPQAG
SRFCQPRLARTLNRLTQEGLDSFYRGPLAQLLGEEFQATGCPLTAQDLAAHRARRRVPLK
LSHRQGDIYNMTPPTQGLVSLAILGITDRMEMADADEALTIHRIVEATKQAFSLRDRYIT
DPRHVTLPVQTLLDRAPLQAMADAISDERAARWGSGKGPGDTVWMGVIDGNGLAVSFIQS
IYHEFGSGVVLPESGVLLQNRGAAFSLDSNHLHALAPGKQPFHTLNPAAARLKDGRTMVY
GTMGGDGQPQTQAAVFTRHVIQGMPLQDAVSAPRWLLGRTWGQATDSLKLEGGFSEATFT
ALRDKGHDVEWLPPMSEVMGHAGAIVRHPNGMLEGAFDPRSNGSAAGF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atcatgcacagtaatatggcaccgggtgcgatggcggtcagtcctcaccacctggccagc
gaatcggcgctctccgtgctgcggcacggcggggacgccattgaagcgatggtcgcggct
gcggccacgatcgccgtcgtctatccgcacatgaacggcatcggcggcgacggcttctgg
cttatcgtgccgcccgaaggggagccggtcgccatcgacgccagcggcgcggcgggcgcg
caggcgacccttgagtactacgcggagcacaaggctatcccgcaccggggcgcgcgggcg
gcgctgaccgtccccggcaccatcagcggctgggatgaagcgctgaagatctccgccggc
ctcggcggcggcactctgccgctctcccgcctgctggccgacgccattcgctacgccgcc
gacggcatcccggtgaccccctcccaggccagcgccacccgcgataaatatcacgaactc
tccggcgtgccgggctttgccaacgcctttttacagcgcggcgacattccccaggccgga
agccgcttctgccagccacgcctggcacgaaccctcaaccgcctcacccaggaggggctg
gacagcttctaccgcgggccgctggctcagctgctgggcgaagagtttcaggccaccggc
tgcccgcttaccgcgcaggatctggccgcccaccgcgcccgccgccgggtaccgctgaag
ctcagccaccgccagggggatatctataacatgacgccgccgacccaggggctggtgtcg
ctggcgatcctcggcattaccgaccgcatggagatggccgacgccgatgaggcgctgact
atccaccgcatcgtcgaagccaccaagcaggcgttctccctgcgcgaccgctatatcacc
gatccgcgccacgtcacgctgccggtgcagacgctgctcgatcgcgcgccgctgcaggcg
atggccgatgccatcagcgatgagcgcgccgcccgctggggcagcggcaaggggccgggc
gatacggtgtggatgggcgttatcgacggcaacgggctggcggtatcctttattcagagc
atctatcacgagttcggcagcggcgtggtgctgccggagagcggcgttctgctgcagaac
cgcggcgccgccttcagcctcgattcaaatcatctgcacgccctggcgccgggcaagcag
ccgttccacaccctcaacccggcggcggcccgcctgaaggacggacgcactatggtctac
ggcaccatgggcggcgacggtcagccgcagacccaggcggcggtgtttacccgccacgtg
atccagggtatgccgctgcaggatgcggtcagcgccccgcgctggctgctggggcgcacc
tgggggcaggcgaccgactcgctcaagctggaaggcggctttagcgaggcgacgtttacc
gccctgcgcgataagggccacgacgttgaatggctgccgccgatgagcgaagttatggga
cacgccggggcgatcgtccgccatccgaacggcatgcttgagggggcgttcgatccgcgc
agcaacggcagcgcggcgggattctga

DBGET integrated database retrieval system