KEGG   Panacibacter ginsenosidivorans: FRZ67_06595Help
Entry
FRZ67_06595       CDS       T06131                                 

Definition
(GenBank) gamma-glutamyltransferase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pgin  Panacibacter ginsenosidivorans
Pathway
pgin00430  Taurine and hypotaurine metabolism
pgin00460  Cyanoamino acid metabolism
pgin00480  Glutathione metabolism
pgin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FRZ67_06595
   00460 Cyanoamino acid metabolism
    FRZ67_06595
   00480 Glutathione metabolism
    FRZ67_06595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pgin01002]
    FRZ67_06595
Enzymes [BR:pgin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     FRZ67_06595
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     FRZ67_06595
Peptidases and inhibitors [BR:pgin01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   FRZ67_06595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: QEC70155
UniProt: A0A5B8VGK9
Position
1596183..1597976
Genome map
AA seq 597 aa AA seqDB search
MAITGKPLAAEAGAMTFQKGGNAVDAACAMLAATCTMWDVLSWGGETQALIYNPKAGKVI
AIDGLGVAPSGATVDFFKNKGMNFPPEYGPLAAVTPGTPGGLCYMLAEYGTMSLKEVLAP
AMQLAAGYPIEAQTANSMERGKKMIKQWPYSTSVFLPHEGQEREAPEAGEIFVQKDLLET
LTKMVDAEQQALKQKKTRKEAIYAAMERFYKGDIAKEFVRGAQEQGGLITMEDLAKWKPI
EEEPLHVNYKGIDVYKLQQWSQGPSMLQALNILENFDLKSMGYNSSRYINTLYQTMSLAF
ADRDFYYGDPYFPPAEPMKGLLDKAYAKQRAALINPDKNDPDIGPGDPYPFEGKTNPYLN
ILKQRGFNVDTDNKTNPGATPSHDATSFVNDSAYMDRLWRGTTSVEAADKDGWVVSVTPS
GGWLPACIAGHTGVGMSQRLQSFVLDSTLDPFNVIEPGKKPRVTLTPTLAMKDGKPFMAF
AVQGGDTQDQNLLQCFLNVVEFGMTIQEAVEAANINTDQLWLSLGGEQVKDRQPHPGSIL
INSNTPDYVRRELIKMGYKLTFDDRTSGPINAIYFDWKHGSFWGGSSNHGEDYGIGW
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaccggcaaaccattagctgctgaagccggtgcgatgacctttcaaaaaggc
ggaaacgctgtagatgcagcgtgtgcaatgcttgcagctacctgcactatgtgggatgta
ttgagttggggtggagaaacacaggcgttgatctataatccaaaagcaggaaaagtaatt
gcgatagatggcctgggtgttgcaccatcaggtgcaactgttgacttctttaaaaacaaa
ggcatgaattttcctccggaatatgggccacttgcagcagtaacaccgggtactccgggt
ggtttgtgttacatgctggcagaatatggcaccatgagtttgaaggaagtgttggcgcct
gccatgcaactggctgcaggctatccgatagaagcgcaaacagccaacagtatggagcgg
ggaaagaaaatgatcaaacaatggccttatagtacatccgtttttttaccacatgaaggg
caggaaagagaagcaccggaagcaggtgaaatatttgtacagaaagacctgttggaaaca
ttaaccaaaatggttgatgcagagcaacaggcattgaaacaaaagaagacacgaaaagaa
gcgatctatgcagcgatggagcgtttttataaaggagatattgcaaaagaatttgtacgc
ggcgcacaggaacagggaggtttgataactatggaagatcttgctaaatggaaaccaatt
gaagaagaaccactacatgtaaattataagggtattgatgtatataagttgcagcaatgg
agccaggggccaagtatgttgcaagcgttgaatatactggagaattttgatctgaagagt
atgggctataattcatcgcgctacattaataccttgtatcaaacaatgagccttgcattt
gctgacagggatttttattatggcgatccgtattttccacccgcagaaccaatgaaaggt
ttacttgataaagcgtatgcaaaacaaagagcggcattaataaatcctgataagaatgat
cctgatattggtcccggtgatccgtatccttttgaaggaaaaacaaatccttatctcaat
attttaaaacagagaggcttcaatgttgatactgataacaaaacaaatcccggtgctaca
ccatcacatgatgcaacatcatttgtaaatgattctgcttacatggatcgcttatggcgt
ggcacaacttcagtagaagcagccgataaagatggctgggtcgtatctgttacacccagc
ggaggttggctacctgcctgcattgcagggcatacaggtgttggtatgagccagcgttta
cagagttttgttttggatagcacgcttgatccattcaatgttattgagcccggaaaaaaa
ccgcgtgttacattaacacctacacttgccatgaaagatggaaaaccttttatggcattt
gctgtgcagggcggcgatacacaggaccaaaatctgttgcaatgtttcctgaatgttgtt
gagtttggaatgacgatacaggaagctgttgaagccgccaacattaatacagaccagtta
tggttatcacttggcggtgagcaggtaaaagaccgtcagccacatcccggaagtatttta
ataaacagcaacaccccggattatgtaagaagagaattaataaagatgggttacaaatta
actttcgatgatcgcaccagcggaccgatcaacgccatttattttgactggaaacacggc
agtttctggggcggttcaagtaatcatggagaagattatggaataggctggtga

DBGET integrated database retrieval system