KEGG   Phaeobacter inhibens 2.10: PGA2_c03180Help
Entry
PGA2_c03180       CDS       T02193                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00020  Citrate cycle (TCA cycle)
pgl00640  Propanoate metabolism
pgl00660  C5-Branched dibasic acid metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
Module
pgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA2_c03180 (sucD)
   00640 Propanoate metabolism
    PGA2_c03180 (sucD)
   00660 C5-Branched dibasic acid metabolism
    PGA2_c03180 (sucD)
Enzymes [BR:pgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PGA2_c03180 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AFO86338
Position
complement(351825..352709)
Genome map
AA seq 294 aa AA seqDB search
MAVLIDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQTHLNLPVFNSVHEA
KHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALEDSKSRLI
GPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTADIGLGQSTAVGIGG
DPIKGTEHIDVLDMFLNDDETQSIIMIGEIGGSAEEEAAEFIAEQKKKGRWKPIAGFIAG
RTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVLKAIGK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcctcatcgacgaaaacaccaaggtcatctgtcagggctttaccggctcgcag
ggcaccttccactccgaacaggccatcgcctatggcaccaagatggtcggcggcgtgacc
ccgggcaaaggtggccagacccacctgaacctaccggtgttcaactccgtacacgaagcc
aagcacgtgaccgaggcgaatgcctctgtgatctatgtgccgcccccctttgcggctgac
tccatccttgaggccatcgatgccgagatggagctgattgtctgcatcaccgagggcatc
ccggttctggacatgatgaaagtgaagcgcgcgctggaagacagcaaatcgcgcctgatc
ggcccgaactgccccggcgtgatcacgcctgatgcctgcaagatcggcatcatgcccggc
cacatccacaaacgtggctcggtcggtgttgtgtcccgctccggcaccttgacctatgag
gcggtgaagcagaccgctgatatcggtctgggccagtccaccgctgtgggcattggcggc
gacccgatcaagggcaccgagcatatcgacgttctggacatgttcctgaacgatgatgag
acccagtcgatcatcatgatcggtgaaatcggtggctccgctgaagaagaagcggcagaa
ttcatcgccgagcagaagaaaaaaggccgctggaagcccatcgcaggctttatcgcaggc
cgcacagcccctccgggccgccgcatgggtcacgccggcgcaatcgttgccggtggcaaa
ggtggtgccgaggacaaaatcgaggcgatgaaatccgctggtattgttgtcgccgatagc
cccgccacactgggcgaggccgtactaaaggccatcggcaaataa

DBGET integrated database retrieval system