KEGG   Phaeobacter inhibens 2.10: PGA2_c04160Help
Entry
PGA2_c04160       CDS       T02193                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00361  Chlorocyclohexane and chlorobenzene degradation
pgl00625  Chloroalkane and chloroalkene degradation
pgl01100  Metabolic pathways
pgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PGA2_c04160
   00361 Chlorocyclohexane and chlorobenzene degradation
    PGA2_c04160
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PGA2_c04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AFO86436
Position
complement(457415..458101)
Genome map
AA seq 228 aa AA seqDB search
MAITTCIFDAYGTLFDVTAAARQAAQEPEFPHLIDHWAELANHWRLKQLQYTWLRAITDA
HTDFWQVTQDGLDWAMEATGLSGDPQLRKRLLDLYWQLQAYEEVPEMLRTLKAAGLQTAI
LSNGSPKMLEGAVNSAGVSGLLDDVLSVEAVGVFKPAAQVYDLVEARFSCQRDEVLFVSS
NGWDAAGAAGYGFTTAWVNRGGEPMDRLPWTPHHVLSDLSSIPKLLGT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacaacctgtatcttcgatgcctatggcacattgttcgacgtgacagcggcc
gcacgacaggctgctcaggagccggagttcccgcatctgatcgaccattgggccgagctg
gccaaccattggcgactgaaacaactacaatacacctggctacgcgccatcaccgatgcc
cacacggatttctggcaggtcacccaagacggattggactgggcaatggaagccaccggc
cttagcggagatcctcagctacggaaacggttgcttgatctctattggcaacttcaggcc
tacgaggaagtgccggagatgctgcgcacgctcaaagcggctggtctgcagacagccatc
ctgtccaatggatcacccaaaatgcttgagggcgcagtaaactccgccggtgtgagcggg
ctgttggacgatgtcctgtctgtagaggccgtcggagtgttcaaacccgctgcacaggtc
tacgacctcgtggaggcccggttcagctgtcagcgcgacgaggtgttgtttgtttcctcc
aacggctgggacgccgccggggcggcggggtatggatttaccacagcctgggtcaatcgt
ggcggcgaaccaatggatcgtctgccctggacgccacatcatgtgttgagcgatctgagc
agtatcccgaaattgcttggtacataa

DBGET integrated database retrieval system