KEGG   Phaeobacter inhibens 2.10: PGA2_c08850Help
Entry
PGA2_c08850       CDS       T02193                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase BioF
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00780  Biotin metabolism
pgl01100  Metabolic pathways
Module
pgl_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PGA2_c08850 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pgl01007]
    PGA2_c08850 (bioF)
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     PGA2_c08850 (bioF)
Amino acid related enzymes [BR:pgl01007]
 Aminotransferase (transaminase)
  Class II
   PGA2_c08850 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Nuc_N OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AFO86897
Position
977485..978624
Genome map
AA seq 379 aa AA seqDB search
MAGAFPRHETSLEALRNRGRYRQLMPRDGHDFASNDYLGLAGSDVLRAAAADALARGVPV
GAGGSRLLRGNDAEHQLLEAEAAAFFGTEAALFMGGGFTANQAIFSTLPQQGDLVLYDAL
IHASTHDGMRLGRAETRSFAHGDVEDASRVLADWRSTGGTGQVWIAVEAVYSMDGDLAPL
DALMALVDVDGAVLVVDEAHSTGVFGDLGRGLAHGIAHRPNVLSLHTCGKALGASGALIC
GQRVLIETLINKARGFIFATAPSPLNAALVRAALAELQQNTGRPEQAWQGITHAQAEAKR
LCGLEGYHSQILPVVIGDDKRTMALAAAMQGHGYDIRGIRPPTVPRGTSRLRLSITLNTG
AQVITQMFEDLAREMESAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccttcccgaggcatgagacatcgctggaagcgctgcgcaatcgcgggcgc
taccggcagctgatgccgcgggacgggcatgactttgcctccaatgactatcttgggctg
gcgggcagcgatgtactgcgcgccgctgccgccgatgcgctggcgcgcggggtgccggtg
ggcgcaggcggttcgcgcctgttgcgcggcaatgacgccgaacatcagttgctggaggca
gaggcggcggcgtttttcggcaccgaggcggcgctgttcatgggcggcggcttcaccgcc
aatcaagcgatcttctcgaccctgccgcagcagggcgatctggtgctgtacgacgcgctg
atccatgccagcacccatgacgggatgcggctgggccgggcagagacccgcagttttgcc
catggcgacgtggaagacgcttcgcgggtgctggcggactggcgctcgacaggtggcacc
ggacaggtctggatcgcggttgaggcggtctattcgatggacggcgacctggccccgctg
gatgcattgatggcgcttgtggatgtggacggcgcggtgctggtggtggatgaggcgcat
tccacaggcgtcttcggcgatctgggccgcgggctggcacacggcattgcgcaccgtcct
aacgtcttgtccctgcacacttgcggcaaggcgctgggggcctctggcgcgctgatctgc
ggtcagcgggtactgatcgagacactgatcaacaaggcgcgcgggttcatctttgccacc
gccccgtcaccgctgaacgccgcgctggtacgggcagccctggctgaactgcaacagaac
acaggccgccccgaacaggcgtggcaggggatcacccatgcgcaagcagaggccaaacgc
ctctgcgggttggagggctatcacagccagatcctgccggtggtgatcggggacgacaaa
cgcaccatggcgctggctgcagcgatgcaaggccacggctatgacatccgcggcatccgc
ccgccaacggtgccccgcggcacctcgcggctgcggctgtcgatcacgttgaacacgggg
gcacaggtcatcacccagatgttcgaagacctcgcccgggaaatggagagtgcagcatga

DBGET integrated database retrieval system