KEGG   Phaeobacter inhibens 2.10: PGA2_c10160Help
Entry
PGA2_c10160       CDS       T02193                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00010  Glycolysis / Gluconeogenesis
pgl00620  Pyruvate metabolism
pgl00640  Propanoate metabolism
pgl00680  Methane metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c10160 (acsA)
   00620 Pyruvate metabolism
    PGA2_c10160 (acsA)
   00640 Propanoate metabolism
    PGA2_c10160 (acsA)
  Energy metabolism
   00680 Methane metabolism
    PGA2_c10160 (acsA)
Enzymes [BR:pgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PGA2_c10160 (acsA)
Lipid biosynthesis proteins [BR:pgl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PGA2_c10160 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF4414
Motif
Other DBs
NCBI-ProteinID: AFO87025
Position
1126637..1128187
Genome map
AA seq 516 aa AA seqDB search
MSGVGGHTLYPGLRTDGGWQFPSCLNMAAQALDHPDEQLALIDLTTGTRRDIRYGELRQM
VDAVAHDLMRRVQPGDRVGVLLSQSVDCAVAHLAIWKIGAISVPLFKLFQHDALASRIGD
AGLELVLTDGGGAAQLGALAQPLLVADILSASAGQSDHLLPYAETTPETPAVLIYTSGTT
GSAKGALHGHRVLSGHLPGVAISHDHLGQPGDCLWTPADWAWIGGLFDVLMPGLALGVPV
VAARLDKFTPEVCADIIRQGDVRNVFFPPTALRLLKAAGRGLDGLRSVASGGEPLGAEML
AWGQRHLGVTINEFYGQTECNMTVSSCVADFPVRPGCIGRPVPGCTVEVLDDTGTPTKDE
GDVAVRRGAASMMLEYWNRPDATAEKFHDDWLITGDRGIWEGDYLRFVGREDDVITSAGY
RIGPAEIEDCLMTHPAVATVGVVGKPDELRTEIVKAYVVLKPGHSPSEKDLQDYVKSRLA
KYSYPREVAFLDALPMTVTGKVIRKELKAQAAREVQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtgggtggacatacattgtatccgggattgcggacggatggcggatggcag
tttccgtcctgcctgaacatggcggcgcaggcgctggaccatccggacgaacaactggcc
ctcattgatctgaccaccggcacgcggcgcgatatccgctatggtgagctgcggcagatg
gtcgatgcggtggcgcacgatctgatgcggcgggttcagcccggtgaccgtgttggtgta
ctgctcagccaatctgtcgactgcgccgtagcacatcttgcgatctggaaaatcggtgcc
atttccgtgccgttgttcaagctgtttcagcatgacgcgctggcctcccgcattggcgat
gcagggttggagctggtgctgactgatggcgggggcgcggcgcagctcggggcgctggcg
caaccgctgctggtggcggatatcctgtccgcaagcgcaggtcaaagcgaccacctcctg
ccttatgcggaaaccacgcctgagaccccggcagtgctcatctacacctccggcaccacg
ggcagcgccaagggcgcgctgcatggtcaccgggtgctctccggtcacctgcccggcgtg
gccatcagccatgatcatctgggccaaccgggcgattgcctgtggacccctgcggattgg
gcatggatcggcggcttgtttgacgtgctgatgccgggtctggcgctgggtgtgccggtc
gtggccgcgcggctggacaagtttacgccggaggtttgcgccgacatcattcgtcagggg
gatgtgcgcaatgtgttctttcctcccactgcgctgcgcttgctgaaggcggcggggcgg
gggctcgacggtctgcgctcggtagcgtctgggggagagcccctgggcgcagagatgctc
gcctggggccagcgtcacctgggcgtgaccatcaatgaattttacggccagaccgaatgc
aacatgacggtttcctcctgcgtcgctgattttccggtgcgcccgggctgcatcggcagg
ccggttccaggatgcacggttgaggtgctggacgacacaggcacccccaccaaagatgag
ggcgacgtcgccgtacgccggggtgctgcgtcgatgatgcttgaatactggaatcgcccc
gacgcgacggctgaaaaatttcatgacgactggctgatcaccggggatcgcggcatctgg
gagggggactatctgcgctttgtcgggcgtgaggatgatgtcatcacttccgccggctac
cgcatcggtccagctgagattgaggactgtctgatgacccatccggccgtggcaaccgtg
ggtgtggtgggcaaacccgatgaacttcgcaccgaaatcgtgaaggcctatgtggtgctg
aaacccggtcactcaccatccgagaaagatctgcaagactacgtcaaatcccgtttggca
aagtattcttacccacgcgaagtggcgttcctggacgcgctgccgatgacggtgaccggc
aaggtgatccgcaaggagctgaaggcacaggcggcgagggaggtacaatga

DBGET integrated database retrieval system