KEGG   Phaeobacter inhibens 2.10: PGA2_c12030Help
Entry
PGA2_c12030       CDS       T02193                                 

Gene name
fadA2
Definition
(GenBank) 3-ketoacyl-CoA thiolase FadA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00071  Fatty acid degradation
pgl00072  Synthesis and degradation of ketone bodies
pgl00280  Valine, leucine and isoleucine degradation
pgl00310  Lysine degradation
pgl00362  Benzoate degradation
pgl00380  Tryptophan metabolism
pgl00620  Pyruvate metabolism
pgl00630  Glyoxylate and dicarboxylate metabolism
pgl00640  Propanoate metabolism
pgl00650  Butanoate metabolism
pgl00900  Terpenoid backbone biosynthesis
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
pgl01212  Fatty acid metabolism
pgl02020  Two-component system
Module
pgl_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA2_c12030 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    PGA2_c12030 (fadA2)
   00640 Propanoate metabolism
    PGA2_c12030 (fadA2)
   00650 Butanoate metabolism
    PGA2_c12030 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PGA2_c12030 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    PGA2_c12030 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA2_c12030 (fadA2)
   00310 Lysine degradation
    PGA2_c12030 (fadA2)
   00380 Tryptophan metabolism
    PGA2_c12030 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGA2_c12030 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PGA2_c12030 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PGA2_c12030 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgl04147]
    PGA2_c12030 (fadA2)
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGA2_c12030 (fadA2)
Exosome [BR:pgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGA2_c12030 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt YfhD
Motif
Other DBs
NCBI-ProteinID: AFO87210
Position
complement(1331794..1333005)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDAVRTPRGKGRKDGSLHEVTAARLSAVALNALKDRNNLEGHAVEDVIWGNVTQ
VGEQGACLARTAVLASDLDESIPGVSINRFCASGLEAVNMAANQVRGRAGHAYIAGGVES
MSRVPMGMDGGAIAVDPAIAIENYFVPQGISADIIATEYGFSRDEADAMAMESQRRAKAA
WDDNRFAGSIVPVRDINGLTILDHDEYMRPGTDMQSLGGLNPAFQMMGEQMPGFDKIALL
KYPHLERINHIHHAGNSSGIVDGAAAVLIGDKEFGEAMGLKPRARIKATAKIGTDPTIML
TGPVPVTEKILRDNGMAIGDIDLFEVNEAFASVVMRFEQAFGVDHDKVNVNGGSIAMGHP
LGATGAMILGALLDELERSDRETGLATLCIGSGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgacgctgtgcgcaccccgcgcggcaagggtcgcaaggat
gggtccttgcatgaagtgacagccgcgcgactgtcggcagtggctctcaacgctctgaaa
gaccgaaacaatctggaaggccacgcagttgaggacgtgatctggggcaatgtcacccag
gtcggcgaacagggcgcctgcctggcgcggaccgctgttctggcctctgacttggatgaa
tccatcccaggtgtctcgatcaaccgtttctgcgcctcgggtctggaagctgtcaacatg
gctgccaaccaggtgcgtggccgcgccggtcacgcctatatcgcgggcggtgtggaatct
atgagccgcgttcccatgggcatggacggtggtgccatcgcggttgatcccgccatcgcc
atcgagaactattttgtcccgcagggcatctccgccgatatcatcgcgaccgaatacggc
ttctcgcgtgatgaggccgacgccatggcaatggaatctcagcgccgggccaaggcggca
tgggacgacaaccggtttgcgggcagcatcgtacccgtgcgcgacatcaacggcctgacc
attctggaccacgatgagtacatgcgccccggcaccgatatgcaatcgctgggcggtctg
aaccccgcgtttcagatgatgggcgagcagatgcccggcttcgacaagatcgcgctgctg
aaatatccgcatctggagcggatcaatcacattcaccacgctggcaactcttccggtatc
gtggatggtgccgctgccgtactgatcggcgacaaagagtttggcgaggcgatgggtctg
aagccgcgggcacggatcaaagcaaccgccaaaatcggtaccgaccccaccatcatgctg
accggccctgtgcctgttacagaaaagatcctgcgcgacaacggcatggcaattggcgac
atcgacctgtttgaggtcaatgaagccttcgccagtgttgtgatgcggttcgagcaggcc
tttggagtggatcatgacaaggtgaacgtcaacggtgggtctattgcgatgggtcacccg
ctgggtgccaccggcgccatgatcctcggcgcactgttggatgagctggagcgcagcgac
cgtgaaaccggtctggcaacgctctgcatcgggtccggcatgggcgcggccaccatcatt
gaacgcgtgtaa

DBGET integrated database retrieval system