KEGG   Phaeobacter inhibens 2.10: PGA2_c15690Help
Entry
PGA2_c15690       CDS       T02193                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase Gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00230  Purine metabolism
pgl01100  Metabolic pathways
Module
pgl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PGA2_c15690 (gmk)
Enzymes [BR:pgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PGA2_c15690 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_18 AAA_33 AAA_16 RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: AFO87571
Position
complement(1729092..1729733)
Genome map
AA seq 213 aa AA seqDB search
MADRRGLLIILSSPSGAGKSTLAKRLRSWDPSIEFSVSATTRNPRPGETDGQDYHFITTD
AFKTAVSEGNMLEHAHVFGNFYGSPKGPVKAAIDGGRDVLFDIDWQGAQQIRNSDLGQHT
LSIFLLPPSIGELRRRLEGRAQDDAATITRRMEKSWDEISHWGSYDHVLINDDLDATELQ
LKTIITATRLRRIQQPHLVDHVRGLQSEFEDLS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcggcgcggcctgttgattatcctttcttcgccctcaggggccgggaaatcc
acattggcgaaacggctgcggtcctgggatcccagcattgaattttccgtctcggccacc
acgcgcaatccgcgtcccggtgaaaccgacgggcaggactatcacttcatcaccactgat
gccttcaagaccgccgtgagcgaaggcaacatgctggagcacgctcatgtcttcggcaac
ttctatggttcgcccaaggggcctgtaaaggcggcgattgatggcgggcgtgacgtgctg
tttgatatcgactggcagggtgcgcagcagatccgcaactcagacctgggtcagcacacg
ctgtcgatcttcctgctgccgccctcgatcggagagttgcgccgccgactggagggccgc
gcgcaggatgatgccgcgaccatcacccgccggatggagaaaagctgggacgaaatcagc
cactggggcagctatgatcacgtgctgatcaacgatgatctggatgccaccgagctacag
ctgaagaccattatcaccgccacccgtctgcgccgcatacagcagccgcatctggtcgac
catgtgcgcggcctgcaaagcgaatttgaggatctgtcatga

DBGET integrated database retrieval system