KEGG   Phaeobacter inhibens 2.10: PGA2_c16200Help
Entry
PGA2_c16200       CDS       T02193                                 

Gene name
arcA
Definition
(GenBank) arginase ArcA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00220  Arginine biosynthesis
pgl00330  Arginine and proline metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01130  Biosynthesis of antibiotics
pgl01230  Biosynthesis of amino acids
Module
pgl_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PGA2_c16200 (arcA)
   00330 Arginine and proline metabolism
    PGA2_c16200 (arcA)
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PGA2_c16200 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFO87620
Position
1784159..1785091
Genome map
AA seq 310 aa AA seqDB search
MRVTSKTCILIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEP
DTNDGLVFARNETIGWTNRLIRAAEEAMKDGLPIFLGGDHSLSLGSVVGVANHAAKEGRP
QFVLWLDAHTDFHTPATSDSGNLHGTPVGYFTGRPDFAGFPEVANPVPQENVCMIGLRSV
DTPERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANGMLHVSLDVDFLDPSVAPA
VGTTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLDERGRTAHLMVDLCASALGRR
VFDRPTRSYQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacatccaagacctgtattctgatcggcgccccggtggacagcggcaagcga
cgcgccggatgcctgatggggccggatgcctatcgcaccgccggtctggggcgcgcaatt
gaaagtctgggtcacaaggtaatcgatcagggcaacctgcgtcctgccacccatgaaccc
gataccaacgacggtctggtctttgcccgcaatgaaacgatcggctggaccaatcgcctg
atccgagccgccgaagaggcgatgaaagatggcctgccgatcttccttggtggcgaccat
tcgctgtccttggggtcggttgttggcgtggccaaccacgcggccaaggaaggccgcccg
caattcgtgctgtggcttgatgcgcataccgatttccatacgcctgcaacctctgacagc
ggcaatctacacgggacgccagtgggctatttcaccgggcgccctgattttgcaggcttt
cccgaagttgccaatccggtcccgcaagaaaacgtctgcatgattggcctgcgttcggtg
gataccccggaacgtctcgcgcttgaggccagcgatattcaccgtcatgacatgcgtgac
atcgacgaaaatggaattgccggtccgctctctgcctttctccagcgggtcaaagatgcc
aacggaatgctgcatgtctcgctcgatgttgattttctggatccgtctgtagcccccgca
gtcggcaccaccgtgcccggcggcgccacagtacgcgagggtcatctggtttgcgaaatg
ctgcatgattccggcctgatgacctcgctcgatctggtggagctgaacccgtttctggat
gagcgcggccgcacggcccatctgatggtggatctctgcgcttcggcccttggtcgccgc
gtctttgaccgcccaacacggagctatcaatga

DBGET integrated database retrieval system