KEGG   Phaeobacter inhibens 2.10: PGA2_c22500Help
Entry
PGA2_c22500       CDS       T02193                                 

Definition
(GenBank) methylmalonyl-CoA epimerase
  KO
K05606  methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00280  Valine, leucine and isoleucine degradation
pgl00630  Glyoxylate and dicarboxylate metabolism
pgl00640  Propanoate metabolism
pgl01100  Metabolic pathways
pgl01120  Microbial metabolism in diverse environments
pgl01200  Carbon metabolism
Module
pgl_M00373  Ethylmalonyl pathway
pgl_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PGA2_c22500
   00640 Propanoate metabolism
    PGA2_c22500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA2_c22500
Enzymes [BR:pgl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     PGA2_c22500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_4 Glyoxalase Glyoxalase_3 Glyoxalase_6
Motif
Other DBs
NCBI-ProteinID: AFO88239
Position
complement(2484621..2485025)
Genome map
AA seq 134 aa AA seqDB search
MIGRLNHVAIAVPDLDAASAQYRNTLGAKVGAPQDEPDHGVTVVFIELPNTKIELLYPLG
EASPIAGFLEKNPAGGIHHICYEVDDILAARDRLKAEGARVLGSGEPKIGAHGKPVLFLH
PKDFNGCLVELEQV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgattggccgcctcaaccacgtcgcaatcgccgtgcccgacctcgacgccgcttcggca
cagtaccgcaacacactgggcgccaaggttggcgcgccgcaggatgagcctgatcacggt
gtcaccgtggtgttcatcgaactgcccaatacgaagattgagctgctctacccgctgggt
gaggcatcgcccatcgcagggtttctggagaagaacccggcgggcggcattcaccacatc
tgctatgaggtggatgatattcttgccgcgcgcgaccggctgaaggctgaaggcgcgcgg
gtgctcggctccggggagcccaagatcggtgcccatggcaaaccggttcttttcctgcat
ccgaaggatttcaacggctgcctggtggaattggaacaggtttga

DBGET integrated database retrieval system