KEGG   Phaeobacter inhibens 2.10: PGA2_c23490Help
Entry
PGA2_c23490       CDS       T02193                                 

Gene name
ltaE3
Definition
(GenBank) low specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00260  Glycine, serine and threonine metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGA2_c23490 (ltaE3)
Enzymes [BR:pgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PGA2_c23490 (ltaE3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AFO88338
Position
complement(2585880..2586965)
Genome map
AA seq 361 aa AA seqDB search
MAGEATGRQWAPLPASADDVVADFYSDMKSIPTKGMLDALLNARVGDVQKGEDPTTTELC
QRVAEMLGKEAAILLPTGTMCNEISIRIHCASGSELIAERSSHIINFEAGGPAALSGVMM
HSIDGEFGRFTAEQVRAAYRPISRYAPETSLVAVEQTTNLGGGGIWSLEELGEIAETSKS
LGLATHMDGARLLNACVETGVSAKQYATGYDSVWIDLTKGLGGFAGAVLAGTDDFINHAW
RYAQQWGGGLRQSGYIAATGLYALDNNLEQLARDNALAKSIGAQIAPLPHISEVLPVETN
IVIFNLDERGPDAATVVSKLRDQGVRLGVFGERTVRIVTHIGVGPEGGDLLIKRLRALLE
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaagctacaggtcgccaatgggcaccactgccggcaagtgcagatgatgtc
gtggccgacttttacagtgacatgaagtcgatcccgaccaaagggatgctggacgcattg
ctcaatgctcgtgttggcgacgttcagaagggtgaggacccgacaacaacggaactgtgt
cagcgcgtggctgaaatgctgggcaaagaggcggcgattttgctgcctacggggacaatg
tgcaatgagatttccattagaattcattgcgcttcaggctctgagctgattgctgaaaga
tcctctcatatcatcaattttgaagcgggtggtcctgcggctctcagcggcgtgatgatg
cattcgattgatggcgaatttgggcgtttcaccgctgagcaagtgcgtgccgcctatcgg
ccgatttcgcgttatgcgccggaaacctcgttggtagcagtcgaacaaacaacaaatctc
ggcggtggcggaatctggagcttggaagagctcggggaaattgcggaaacctcaaaatcg
ctgggattggcgacacatatggatggtgcgcggttgttgaacgcctgtgtggaaaccggg
gtctccgccaagcaatatgcgactggctatgactctgtctggatcgacctcaccaaggga
ttgggcggttttgccggtgcggttctggccgggacggacgactttatcaaccacgcctgg
cgctatgcgcagcaatggggcggcgggttgcgccagtccggttacatcgccgcgaccggg
ctttatgcgctggataacaatcttgaacaactggcccgtgacaatgcactggccaaaagc
attggtgcgcagatcgcgcccttgccgcatatctcagaggttttgccggttgagaccaac
atcgtgatcttcaatctggatgaacgcggaccggatgcggcaacggtcgtgtccaagttg
cgggaccagggcgtccgccttggtgtctttggcgaacggacggttcggatcgttactcat
atcggcgtagggcctgagggcggagatctgttgatcaaacgcctgcgcgccctcctggaa
gaatag

DBGET integrated database retrieval system