KEGG   Phaeobacter inhibens 2.10: PGA2_c24670Help
Entry
PGA2_c24670       CDS       T02193                                 

Gene name
coaBC
Definition
(GenBank) coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00770  Pantothenate and CoA biosynthesis
pgl01100  Metabolic pathways
Module
pgl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PGA2_c24670 (coaBC)
Enzymes [BR:pgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     PGA2_c24670 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     PGA2_c24670 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein IlvN Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AFO88449
Position
complement(2722999..2724201)
Genome map
AA seq 400 aa AA seqDB search
MLANKRILLIIGGGIAAYKSLELIRRLQDQGAEVVPVLTKAGEEFVTPLSVSALAGQAVH
RDLFDLTAEAEMGHIQLSRTADLLVVAPATADLMAKMANGHANDLASTLLLATDTPVLLA
PAMNVRMWQHPATQRNLQILLADGVACVGPDEGGMACGEFGPGRLAEPDAIVTAIVAKLS
DGPLKGQRIVLTSGPTHEPIDPVRYIANRSSGAQGTALARALRDLGAEVVFITGPASVAP
PEGVEVVAVETAQEMADAVTAALPADAGVFAAAVADWRVTSASDRKLKKSKDGLPVMEFA
ENPDILKTVSHLDEGRPRLVVGFAAETNDVVENATAKRLRKGCDWIIANDVSPATGIMGG
SENAVVLISDQGAESWPRMDKGAVARQLADRIAAALTERG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgaacaaacgtattctcctgatcatcggcggcggaattgccgcctataaatcg
ctggagctgatccgtcggctgcaggatcagggtgccgaggtggtgccggtcctgactaag
gcgggagaggaatttgtgacccccttgtcagtctctgcactggccgggcaggcagtccac
cgggacctgtttgatctgacagccgaggctgagatgggccatatccaactgtcgcgcacc
gcggatctactggtggtggccccggcaaccgcagatctgatggcgaagatggccaatggt
cacgccaatgatctggcctccaccctgctgctggcaaccgatacgccggtgctgttggcg
cccgcgatgaatgtgcgcatgtggcagcatccggcgacccagcgcaatcttcagatcctg
ctggcggatggtgttgcttgcgttggcccggatgagggcggcatggcctgcggtgaattt
ggccccggccgtctggcggaaccggacgccattgttaccgcgattgtcgccaaactgtcc
gacgggccgctgaagggacagcgtattgtcctgacctccggccccacccatgagccgatc
gacccggtgcgctatatcgccaaccgctcatccggggcgcagggaactgcgctggcccgt
gctctgcgcgatctgggcgctgaggtggtcttcatcacgggcccggcaagtgtcgcgccg
cccgagggggttgaggtggtggccgtggagaccgcgcaagagatggccgacgctgtgacc
gccgccctacctgcggacgccggtgtctttgccgcagccgtggccgactggcgggtcacc
agcgcctctgatcgcaagctgaagaaatcgaaggatggcctgccggtgatggaatttgcc
gaaaaccccgacatcctcaaaaccgtgtcgcatctggatgaggggcggccgagacttgtt
gtggggtttgcggcagaaaccaatgatgtggtggaaaacgccaccgccaaacgcctgcgc
aagggctgtgactggattattgccaatgatgtctcccccgcgacaggtatcatgggcggt
agcgaaaacgcggttgtgctgatctcagatcaaggcgcagagagctggccgcgcatggac
aagggcgctgtcgcacgtcaattggcggatcgcatcgcagcggcgctcacagagagaggc
tga

DBGET integrated database retrieval system