KEGG   Phaeobacter inhibens 2.10: PGA2_c26780Help
Entry
PGA2_c26780       CDS       T02193                                 

Gene name
ackA
Definition
(GenBank) acetate kinase AckA
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00430  Taurine and hypotaurine metabolism
pgl00620  Pyruvate metabolism
pgl00640  Propanoate metabolism
pgl00680  Methane metabolism
pgl01100  Metabolic pathways
pgl01120  Microbial metabolism in diverse environments
pgl01200  Carbon metabolism
Module
pgl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA2_c26780 (ackA)
   00640 Propanoate metabolism
    PGA2_c26780 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    PGA2_c26780 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PGA2_c26780 (ackA)
Enzymes [BR:pgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     PGA2_c26780 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFO88654
Position
2959343..2960503
Genome map
AA seq 386 aa AA seqDB search
MTSSAGTDILVLNAGSSSIKFAIFDTDLTQRISGLAEGIGTPQSCLRIADTSSDSQFPTH
AEALAAILAALPEHGLDPTQLAAVGHRVVHGGRKLTKPLRITPEIRAEIADCTPLAPLHN
PHSLAAIDTMAATAPDLPQFASFDTSFHATNPEVATRYAIPRVEETKGIRRYGFHGLSYA
SLVRRLPEISGAPLPSRLLAFHLGNGASLCAIRNGQSIATTMGYSPLDGLTMGTRSGGID
ANAVLRLVEDNGLERTKAILNNESGLLGLSGGKSDMRNLMLDPSADSAFAIEHFCYWSLR
HAGSLIAAMEGVDAIAFTGGIGENALGVRAGILRGLEWIGARMDVDANHARKSRLHAGSS
KVAIWVVEAEEERQIAMDAQALMGAS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacctcatctgctggcaccgacattctggtcctcaatgccgggtcctcttctatcaaa
tttgcgatctttgatacggatctcacccagcgcatttcgggcctagctgaggggatcggc
acgccgcaatcgtgcctgcgcatcgcagacaccagtagcgacagccagttccccacccac
gccgaagcgctcgctgcgatcctggcggcactgcccgagcacgggcttgacccaacacag
ctggcagccgtggggcacagggtcgtgcatggcggacgcaagctgaccaaaccactgcgc
atcacccccgaaatccgggccgaaatcgccgactgcacaccgcttgccccgctgcacaac
ccgcacagcctcgcggcaattgacacgatggccgccaccgcgcccgacctaccgcagttt
gccagctttgacacgtcgtttcacgccaccaacccagaagtcgcaacgcgctatgcgatc
ccgcgcgtggaagaaaccaagggcatccgccgctatgggtttcacggtctgtcctacgcc
tcgctggtgcggcgcctgccggaaatttccggcgcccccctgccctcgcgcctgctggca
tttcacctcggcaacggcgcctcgctttgcgcgatccgcaatggccagtccatcgccacc
accatgggctattcgccgctggatggcctgaccatgggcacgcggtcgggcgggattgac
gccaatgcggtgctgcgcctggtcgaagacaacgggctggaacgcaccaaagcgatccta
aacaacgaaagcgggctgttgggcttgtccggcggcaaatccgacatgcgcaacctgatg
ctagaccccagcgctgacagcgcctttgccatcgaacatttctgctattggagcctgcgt
cacgcgggcagcctgattgccgccatggaaggtgtggatgccatcgccttcaccggtgga
atcggtgaaaacgcgttgggtgtgcgtgccggcattctgcgcggtctggaatggatcggc
gcgcggatggatgtggatgccaaccacgcccgcaaatcgcgcctgcatgcgggcagctcc
aaggtggcgatctgggtggtcgaggccgaggaagaacgccagatcgccatggatgcccag
gccctgatgggggcgtcatga

DBGET integrated database retrieval system