KEGG   Phaeobacter inhibens 2.10: PGA2_c26790Help
Entry
PGA2_c26790       CDS       T02193                                 

Definition
(GenBank) phosphate actetyl/butyryl transferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00430  Taurine and hypotaurine metabolism
pgl00620  Pyruvate metabolism
pgl00640  Propanoate metabolism
pgl00680  Methane metabolism
pgl01100  Metabolic pathways
pgl01120  Microbial metabolism in diverse environments
pgl01200  Carbon metabolism
Module
pgl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA2_c26790
   00640 Propanoate metabolism
    PGA2_c26790
  09102 Energy metabolism
   00680 Methane metabolism
    PGA2_c26790
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PGA2_c26790
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     PGA2_c26790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AFO88655
Position
complement(2960541..2961392)
Genome map
AA seq 283 aa AA seqDB search
MTVLENAYALARERKARVVFPEMDDSRVAAAVDQLTREGLVEAVPLAPVSAAHVEVLVAA
RGMKEGIAKRMLSKPLYRAAAMVAAGEADAMVAGADVPTRRVIEAASIGIGLDAGVSTAS
SFFLMLFPDGRELVFADCAVNVAPDAAQLADIARASARSAEALLGSAGVAMLSFSTGTSG
DGDSVALVRAAAEASGFAGPVQADAALNSAIAEKKGIAPVEANVLIFPTLDAGNIGYKLC
QELSGAQALGPFLQGFAKPVCDLSRGASVEDIVAATVLTVAQI
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacttgaaaacgcatatgcgctggctcgggaacgcaaggcacgggtggtgttt
cccgaaatggacgattccagagtggccgccgccgtggaccagctgacccgtgaggggctg
gtggaggcagtgcctttggcgccggtgtctgcggcgcatgtagaggtgttggtggcggcg
cgcggcatgaaagaaggcattgccaaacggatgctctccaaacccttgtaccgcgcggcg
gcgatggtggctgcgggtgaggcggatgcaatggtggcgggcgcggatgtacccacgcgc
cgggtgatcgaggcggccagcatcggcatcgggctggatgccggggtcagcaccgcgtcg
tcgtttttcctgatgctgtttccggacgggcgcgaattggtgtttgccgattgcgccgta
aatgtcgcgccggatgccgcgcaactggcggatatcgcgcgggcctctgcgcgttcggcg
gaggcgctgctggggtctgcgggggttgcgatgctgtcgttttctaccggcacctcaggc
gatggcgacagcgtggcgctggtgcgcgcggcggcagaggccagcggtttcgcaggcccg
gtgcaggcggatgcggcgctgaattctgcgattgccgagaagaaaggcatcgcccctgtt
gaggccaacgtgctgattttcccaacgttggatgcggggaacatcggatacaagctttgc
caggaattgagcggcgcgcaggcgctggggccgttcttgcagggctttgccaagccggtc
tgcgatctgagccggggcgcctcggttgaggacatcgtggcggcgaccgtgctgacggtg
gcgcagatctga

DBGET integrated database retrieval system