KEGG   Paenibacillus graminis: PGRAT_00490Help
Entry
PGRAT_00490       CDS       T03325                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00790  Folate biosynthesis
pgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PGRAT_00490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgm04147]
    PGRAT_00490
Enzymes [BR:pgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PGRAT_00490
Exosome [BR:pgm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGRAT_00490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AIQ66303
UniProt: A0A089M481
Position
102461..102748
Genome map
AA seq 95 aa AA seqDB search
MQFMEEELREQVSKLEGWKLEQDTLVRKYMFNEYMKGIAFVDEVAAISEAFEHHPHITVD
YKTVFLRLSAAEEEGLTALDIRQAHEFNEAFEKNR
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatttatggaagaggagctgcgggagcaggtgagcaagctggaaggatggaaactg
gagcaggatactctggtgcgcaaatacatgttcaatgaatatatgaaggggattgctttt
gtggacgaggtggcggctatatcggaagcattcgagcatcatccgcatattacagttgat
tataaaacggtcttccttcgcctgtctgcggcagaggaggaggggcttaccgcacttgat
atccggcaggctcatgaatttaacgaagcctttgagaagaaccgttaa

DBGET integrated database retrieval system