KEGG   Paenibacillus graminis: PGRAT_02180Help
Entry
PGRAT_02180       CDS       T03325                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00071  Fatty acid degradation
pgm00072  Synthesis and degradation of ketone bodies
pgm00280  Valine, leucine and isoleucine degradation
pgm00310  Lysine degradation
pgm00362  Benzoate degradation
pgm00380  Tryptophan metabolism
pgm00620  Pyruvate metabolism
pgm00630  Glyoxylate and dicarboxylate metabolism
pgm00640  Propanoate metabolism
pgm00650  Butanoate metabolism
pgm00900  Terpenoid backbone biosynthesis
pgm01100  Metabolic pathways
pgm01110  Biosynthesis of secondary metabolites
pgm01120  Microbial metabolism in diverse environments
pgm01130  Biosynthesis of antibiotics
pgm01200  Carbon metabolism
pgm01212  Fatty acid metabolism
pgm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGRAT_02180
   00630 Glyoxylate and dicarboxylate metabolism
    PGRAT_02180
   00640 Propanoate metabolism
    PGRAT_02180
   00650 Butanoate metabolism
    PGRAT_02180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PGRAT_02180
   00072 Synthesis and degradation of ketone bodies
    PGRAT_02180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGRAT_02180
   00310 Lysine degradation
    PGRAT_02180
   00380 Tryptophan metabolism
    PGRAT_02180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGRAT_02180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PGRAT_02180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PGRAT_02180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgm04147]
    PGRAT_02180
Enzymes [BR:pgm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGRAT_02180
Exosome [BR:pgm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGRAT_02180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIQ66591
UniProt: A0A089LYI1
Position
complement(470434..471618)
Genome map
AA seq 394 aa AA seqDB search
MKKVALVSPLRTAVGSFNNGLSTLSATELGANVMSACLQQSQLEPALIDQIYLGNVLQAG
TGQNPARQAALKAGIPIDVPASTINTVCGSGLHAVALAYNSILAEQGSILLAGGMESMSN
APYLLRNARNGYKLGNGELIDSVVADGLTCPINKYHMGITAENIAEKYNISRLEQDEFAY
GSQVKAKEAKQKQVFAEQIVPVRTKIKKADIWFSEDEHVRGDTSKEKLSNLKPVFKENGS
VTAGNASGINDGAAAVLVMSEDKCKEHAVQPLAYIRGYSLVGVDPAYMGMGPVRAISSLL
KDQGISLNSIDLFEINEAFAAQALAVIKELGVNPEKVNVNGGAIAIGHPVGASGARILVT
LVHEMVRRSSRYGVASLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagttgcattggtgagcccattaagaacagccgtgggttcttttaacaacgga
ctttcaacacttagcgctacagaattgggagctaacgtgatgtcagcctgccttcagcaa
agccaattagagcctgcgttgattgatcagatttatttagggaatgtccttcaagcgggc
actggccaaaatcctgccagacaggcggcactaaaagccggcatccccattgacgtacct
gcatcaaccataaacacggtttgcggttcagggcttcatgccgtcgctttagcttacaac
tctattctggcagaacaaggcagcatcctcttggctggaggtatggagagcatgtcgaac
gccccatatctgctaaggaatgcacgaaatggttacaagcttggcaacggcgaattgata
gacagcgtggtagccgacggccttacgtgtcccatcaataaatatcacatgggaattacc
gcagaaaatattgccgagaaatataacatttcaaggcttgagcaggatgaatttgcctat
ggaagccaggtcaaggccaaagaggcaaaacaaaagcaggtctttgcagaacagattgtt
cccgttaggaccaaaatcaaaaaagcagatatttggttctcggaggatgaacatgtaaga
ggggatacaagcaaagaaaaactttctaatttaaaacctgtatttaaggaaaatggatcg
gttactgccggaaatgcttcggggatcaatgatggagcggcggctgtacttgtgatgtcg
gaagacaaatgcaaggaacatgcggtacaaccattggcctatatcaggggttattcactg
gttggcgttgaccctgcatatatggggatgggtccggtgagagctatttcgtcactgctt
aaagatcagggaatctccctcaattccattgatctatttgagattaatgaagccttcgct
gcacaagcattagcggtaataaaagagcttggggtcaacccggagaaggtgaatgtcaat
ggcggcgcaatcgcgattggacatcctgtcggtgcaagcggagccagaatattggttaca
ttggtgcatgaaatggtacgaagatcttcgcgttacggcgtagcctcgttatgtattgga
acgggaatgggaatcgcaatgctggttgagaatgcactcatctaa

DBGET integrated database retrieval system