KEGG   Paenibacillus graminis: PGRAT_06805Help
Entry
PGRAT_06805       CDS       T03325                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00480  Glutathione metabolism
pgm00590  Arachidonic acid metabolism
pgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PGRAT_06805
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PGRAT_06805
Enzymes [BR:pgm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PGRAT_06805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AIQ67379
UniProt: A0A089NEH3
Position
complement(1511481..1511963)
Genome map
AA seq 160 aa AA seqDB search
MSIYDYEANTLRGQEESLSKYKGKVLLVVNTASKCGFTPQYKGLQEVYDKFKDRGFEVLG
FPSNQFAGQEPGESEDIAEFCEINYGVTFPMYEKIDVKGDGAHPLFKYLSKEAPGVLGSK
SVKWNFTKFLVDQEGHVLKRFAPQTTPDQIEADIAKLLEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttatgattatgaagccaacacgctgcgcggtcaggaagaatccctatccaag
tacaaaggcaaagtgctgctcgtcgtcaatacagccagcaaatgcggctttactccccag
tataagggtctccaggaagtgtatgataaattcaaggaccgcggttttgaagtcctgggc
tttccaagcaatcagtttgcaggccaagagcctggtgaaagtgaagacatcgcagagttc
tgcgagatcaattacggggtcaccttcccgatgtacgagaagattgatgtgaagggtgac
ggggcgcatccgcttttcaaatatctctccaaggaagcaccgggcgtactcggctccaaa
agcgtcaaatggaacttcacgaagttcctggtagaccaggagggccatgtgctgaagcgg
ttcgccccgcagaccacaccggaccagatcgaggccgatatcgccaagctgcttgagaaa
taa

DBGET integrated database retrieval system