KEGG   Paenibacillus graminis: PGRAT_18685Help
Entry
PGRAT_18685       CDS       T03325                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00020  Citrate cycle (TCA cycle)
pgm00640  Propanoate metabolism
pgm00660  C5-Branched dibasic acid metabolism
pgm01100  Metabolic pathways
pgm01110  Biosynthesis of secondary metabolites
pgm01120  Microbial metabolism in diverse environments
pgm01130  Biosynthesis of antibiotics
pgm01200  Carbon metabolism
Module
pgm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGRAT_18685 (sucC)
   00640 Propanoate metabolism
    PGRAT_18685 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PGRAT_18685 (sucC)
Enzymes [BR:pgm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PGRAT_18685 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AIQ69439
UniProt: A0A089NK84
Position
complement(4217975..4219132)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLKKYGVAVPNGKVAYTVEEAVEAAASLGTPVVVVKAQIHAGGRGKAGGV
KVAKSSEEVRAYAEEILGKTLITHQTGPEGKVVKRLLIEEGCQIVKEYYIGLVVDRGSGR
VVMMASEEGGTEIEEVAATHPEKIFKEIIDPAVGLQTFQARKLAYSIAIPTELVNKAVKF
MQALYLAFVDKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALFRHKDILELRDLDEEDA
KEIEASKFDLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDVGGGATTEKVTE
AFKIILSDDKVNGIFVNIFGGIMRCDVIASGVVEAARQLGLTKPLVVRLEGTNVALGKEI
LAGSGLNIVAADSMADGARKIVALV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcagggaaaagaagtacttaagaagtacggcgtcgccgtaccg
aacggaaaagtagcttatacagtggaggaagcggtggaagccgcagcatcgctggggacc
ccggtggtagtggtaaaagcgcagattcatgctggcgggcgcggtaaggccggaggcgtg
aaggtcgccaaatcaagcgaagaggtacgggcgtatgctgaagagattctcggaaagacg
ctgattacccatcagaccggtccggaagggaaggtagtcaaacggcttctcattgaagaa
ggctgccagattgttaaggaatactacatcggacttgtagtcgaccgtggctccgggcgt
gtggtgatgatggcttcggaggaaggcggaacagagattgaagaggttgcggcaacgcat
ccggagaagatttttaaggaaattattgatcctgcagtagggctgcagacttttcaagcc
cgtaaactggcgtacagcattgcgattcccacggagctggtcaataaagcggttaagttc
atgcaagcgctctatttagcttttgtggataaggattgctccattgccgaaattaaccct
ctggttgtgaccggggatggaaatgtcatggcactggatgccaagctgaactttgactcc
aatgcattgttccggcacaaggatattcttgagctgcgcgaccttgatgaagaggatgca
aaggagattgaagcatccaaattcgatctcagctacatcgcacttgacgggaatatcggc
tgcatggtgaacggtgccggtctggccatggctacaatggatattatcaaatattatgga
ggcgagccggccaacttcctggatgtagggggcggtgccactactgagaaggttaccgag
gctttcaaaattattttgtccgatgacaaggtgaatggaatattcgtcaatattttcggc
gggatcatgcgctgtgatgtcattgcgagcggcgtagtggaggctgccagacagctcggc
ctgaccaaaccgcttgttgtgcgccttgaaggcaccaatgttgcgctgggcaaagagatt
cttgccggttcggggctgaatattgtggcagcagactcaatggcggacggggcccgtaag
attgtagctcttgtgtaa

DBGET integrated database retrieval system